Conserved Protein Domain Family
PRK13938

?
PRK13938: PRK13938 
phosphoheptose isomerase; Provisional
Statistics
?
PSSM-Id: 139997
View PSSM: PRK13938
Aligned: 7 rows
Threshold Bit Score: 381.006
Threshold Setting Gi: 15607255
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15607255    1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
31791291    1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
148659876   1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
148821305   1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
121636026   1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
224988499   1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
253797031   1 MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAGARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGA 80 
15607255   81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
31791291   81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
148659876  81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
148821305  81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
121636026  81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
224988499  81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
253797031  81 EALHANSSHLTAVANDYDYDTVFARALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADF 160
15607255  161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
31791291  161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
148659876 161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
148821305 161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
121636026 161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
224988499 161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
253797031 161 LINVPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap