Conserved Protein Domain Family
PRK13932

?
PRK13932: PRK13932 
stationary phase survival protein SurE; Provisional
Statistics
?
PSSM-Id: 172445
View PSSM: PRK13932
Aligned: 11 rows
Threshold Bit Score: 521.64
Threshold Setting Gi: 193214852
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194334640   1 MTDNRPHILVCNDDGIDAEGLHALAVSMKKIGRVTVVAPAEPHSGMGHAMTLGVPLRIKSYEKNNRFFGHTVSGTPVDCI 80 
194337400   9 DTAQKPHILVCNDDGIEGEGIHVLAAAMKKIGRVTVVAPAEPHSGMSHAMTLGVPLRIKKFMKNNRFFGYTVSGTPVDCI 88 
193212071   5 NKPKKPHILVCNDDGIEGPGLHALAASMKKLGSVTIVAPADPHSGMSHAMTLGEPLRIREYRKNNRFYGHTVSGTPVDCI 84 
193214852  19 ASQTKPKILVTNDDGIDAEGIRVLAQSMQRIGDVTVVAPASPQSGMSHAMTLGRPLRIQKVYKNKKLFGYSVSGTPVDCV 98 
189345944   2 NELKKPHILVCNDDGIEGEGIHVLAASMKKIGRVTVVAPAEPHSGMSHAMTLGVPLRIKEYQRNNRFFGYTVSGTPVDCI 81 
189500962   7 GSGKKPHILVCNDDGIDAEGLHVLAASMRKIGTVTVVAPSEPRSGMAHAMTLGVPIRINKQTKNNRFFGYSVSGTPVDCI 86 
21674375    3 TKPQKPHILVCNDDGIEGLGLHALAASMKKLGSVTVVAPAEPQSGKSHGMTLGEPLRIRRYQKNNRFFGYTVSGTPVDCI 82 
78186249    3 KQDRRPEILVCNDDGIEGEGIHVLAASMKKLGNVTVVAPAEPHSGMSHAMTLGVPLRIREFRRNNRFFGHTVSGTPVDCI 82 
78188272   16 SNATLPHILICNDDGIEADGIHALATAMKKVGRVTVVAPAEPHSAMSHAMTLGRPLRIKEYQKNGRFFGYTVSGTPVDCI 95 
119357826   2 DQLKKPHILLCNDDGIEGEGLHALAASMKKIGNITVVAPAEPHSGMSHAMTLGTPLRIKKYYKNNRFFGYTVSGTPVDCV 81 
145219235   3 KQDRRPEILVCNDDGIEGEGIHVLAASMKKLGNVTVVAPAEPHSGMSHAMTLGVPLRIKEFRRNNRFFGHTVSGTPVDCI 82 
194334640  81 KAALSHILKEKPDIIVSGINYGSNTATNTLYSGTVGAALEGRIQHIPSLAFSLTTYENANFTYAAKFARKLVRKVLREGL 160
194337400  89 KVALSHILPSKPDLIVSGINYGSNTATNTLYSGTIGAALEGAIQGITSLAFSLTTYEHADFTYAGKFARKLAKKVLLEGL 168
193212071  85 KVALSHILDEKPDLIVSGINYGSNTAMNTLYSGTVAAAIEGVIQGVPSLAFSLTTYENADFTYAAKFARQLARETLKRGL 164
193214852  99 KVAMTHILKDRPDLVVSGINYGSNTAINILYSGTIGAAVEGRIYEIPSIAFSLTTYENADFSYAGKVARQIAKKVLEKGL 178
189345944  82 KVALSHILDDKPDILVSGINYGSNTATNTLYSGTVAAALEGAIQGITSLAFSLATYEHADFTYAGKFARKLAKKVLQQGI 161
189500962  87 KVALNHILPEKPDLIVSGINYGSNTATNTLYSGTLGAALEGVIQYVPSLAFSLATYKDADFTYAGKFARKLARKVLREGL 166
21674375   83 KVALSHILDAKPDLIVSGINYGSNTAMNSLYSGTVAAAREGAIQNVPSLAFSLTTYENADFTYAAKFARQLAREVLRRGM 162
78186249   83 KVALSHIMKVKPDLIVSGINYGSNTAMSTLYSGTVAAALEGAIQGVTSLAFSLTTYEHADFTYAGKFARKLARKVLQEGL 162
78188272   96 KVALSHILTEKPDILVSGINYGSNTATNTLYSGTVAAALEGAIQGITSLAFSLATYENADFTYATKFARKLTKKVLAEGL 175
119357826  82 KVALSQILPSKPDLLVSGINYGSNTATNTLYSGTVAAALEGAIQGITSLAFSLATYENADFSYAAKFARKLSKKVLTEGL 161
145219235  83 KVALSHIMPVKPDLIVSGINYGSNTATSTIYSGTVAAALEGAIQGVTSIAFSLTTYEHADFTYAGKFARKLARKVLQKGL 162
194334640 161 PEDTILSVNIPNVDEKDIQGVAITRQGKSRWAEDTIERDDMYGNPYYWLSGRLQLMDDDMQQDEYAVRQNYVAITPIAVD 240
194337400 169 PPDTILSVNIPNVPESGITGIVITEQGRSRWEEDAIERNDMFGNPYYWLNGTLRLLDESLRKDEFAIRQNYVTVTPLSCD 248
193212071 165 PTDTILSANIPNVPEDEIKGILITRQGKSRWEESAIERHDVYGNPYYWLGGTLLLHDEELTQDEYAVRHNYVAVTPLNCD 244
193214852 179 PPRTLLSVNIPNVPESDIQGIVVTRQGRSCWQESMIEHHDPYGQPYYWLNGMMALYDDKLTDDEYAIRHNYVSVTPLRFD 258
189345944 162 PADTILSVNIPNVPESEIAGVLSTSQGRSRWEENAIERNDMYGNPYYWLNGTLKLLDDSLRQDEYAVRRNYVTVTPLSCD 241
189500962 167 PPDTILSVNIPNLPESAVRGVAITAQGKSRWAENTIEREDMYGNPYYWLSGELQLLDNEMLYDEYAVKQHYVAITPVSID 246
21674375  163 PPDTILSANIPNVPEKEIRGILFTRQGRSRWEESTIERHDMYGNPYYWLAGSLQLHDNDLAEDEYAVRHNYVAVTPITCD 242
78186249  163 PEDTILSVNIPNVPEADIQGVRITGQGRSRWSEDAIERNDMYGNPYYWLNGTLMLLDEGMESDEFAVRRNFVTLTPLSCD 242
78188272  176 PADTILSVNIPNVPESQIAGVIIAEQGSSRWEEQAIERHDMFGNPYYWLSGSLQLMDHSMKKDEFAVRHNYVAVTPISCD 255
119357826 162 PPDTILSVNIPNIPESEIQGILVTEQGRSRWEEDAIERHDVYGNPYYWLNGTLMLLDTSLQHDEYAVRKHYVAVTPISCD 241
145219235 163 PADTILSANIPNVPESDIAGVVITRQGRSRWSEDAIERNDMYGNPYYWLNGTLRLQDSEMDKDEYAVRRNFVTITPLSFD 242
194334640 241 MTNHQALQPLKQWKLKK 257
194337400 249 LTNHPFIGTLEQWNLQK 265
193212071 245 WTDHRFRSELETWGLNK 261
193214852 259 LTNYDFMESLTSWKFKK 275
189345944 242 LTNHTFLDSLNQWNLQK 258
189500962 247 MTNHSALKALRRWKLNR 263
21674375  243 MTDHRFRSELETWGLQN 259
78186249  243 LTRHGFRSTLEQWKLKK 259
78188272  256 LTNYAALAGLEKWKLKK 272
119357826 242 FTNRDFMGSLEQWNLKK 258
145219235 243 LTNRDFLGTLEQWKLQQ 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap