Conserved Protein Domain Family
PRK13916

?
PRK13916: PRK13916 
plasmid segregation protein ParR; Provisional
Links
?
Statistics
?
PSSM-Id: 139976
View PSSM: PRK13916
Aligned: 6 rows
Threshold Bit Score: 43.2453
Threshold Setting Gi: 87159869
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58616179    8 PQKDSLRLTLYLNRKKHSELFEFLVALPDGTMPTFVRDVLEKYIQSGGFSSPLPQQNRTregDALLPSTTPIRVAQSKAH 87 
87159869    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77 
32470397    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77 
33416290    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77 
226464401   1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77 
281427766   1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77 
58616179   88 AIELPPDADPGKLYPKHWSS 107
87159869   78 DAMERKDQLKQAEMPKIEEK 97 
32470397   78 DAMERKDQLKQAEMPKIEEK 97 
33416290   78 DAMERKDQLKQAEMPKIEEK 97 
226464401  78 DAMERKDQLKQAEMPKIEEK 97 
281427766  78 DAMERKDQLKQAEMPKIEEK 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap