Conserved Protein Domain Family
PRK13911

?
PRK13911: PRK13911 
exodeoxyribonuclease III; Provisional
Statistics
?
PSSM-Id: 139971
View PSSM: PRK13911
Aligned: 9 rows
Threshold Bit Score: 496.524
Threshold Setting Gi: 109946643
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15646134    1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
15612480    1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
108563814   1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFRGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
109946643   1 MKLISWNVNGLRACMTKGFMDFFNSVDADIFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
188528295   1 MKLVSWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQDQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
208435390   1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
210135690   1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVNYGI 80 
254780031   1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFKGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
298735503   1 MKLISWNVNGLRACMTKGFMDFFNSVDADVFCIQESKMQQEQNTFEFNGYFDFWNCAIKKGYSGVVTFTKKEPLSVSYGI 80 
15646134   81 NMEEHDKEGRVITCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
15612480   81 DIKEHDKEGRVVTCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
108563814  81 NIEEHDKEGRVVTCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
109946643  81 NIEEHDKEGRIITCEFESFYLVNIYTPNSQQALSRLNYRMSWEVEFRRFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
188528295  81 NIEEHDKEGRVVTCEFELFYLVNVYVPNSQQALSRLSYRMSWEVEFRKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
208435390  81 NMEEHDKEGRVVTCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFRKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
210135690  81 NMEEHDKEGRVITCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
254780031  81 NIEEHDKEGRVITCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
298735503  81 NIEEHDKEGRVITCEFESFYLVNVYTPNSQQALSRLSYRMSWEVEFKKFLKALELKKPVIVCGDLNVAHNEIDLENPKTN 160
15646134  161 RKNAGFSDEEREKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
15612480  161 RKNAGFSDEEREKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKDIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
108563814 161 RKNAGFSDEERGKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
109946643 161 RKNAGFSDEERGKFNELLNTGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSNSLKTRLKDALIYKDILGS 240
188528295 161 RKNAGFSDEERGKFNELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSHPLKTRLKDALIYKDILGS 240
208435390 161 RKNAGFSDEERGKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
210135690 161 RKNAGFSDEERGKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKNIGWRIDYFLCSNPLKTCLKDALIYKDILGS 240
254780031 161 RKNAGFSDEEREKFNELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKDIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
298735503 161 RKNAGFSDEERGKFSELLNAGFIDTFRYFYPNKEKAYTWWSYMQQARDKDIGWRIDYFLCSNPLKTRLKDALIYKDILGS 240
15646134  241 DHCPVGLELV 250
15612480  241 DHCPVGLELV 250
108563814 241 DHCPVGLELV 250
109946643 241 DHCPVGLELV 250
188528295 241 DHCPVGLELV 250
208435390 241 DHCPVGLELV 250
210135690 241 DHCPVGLELV 250
254780031 241 DHCPVGLELV 250
298735503 241 DHCPVGLELV 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap