Conserved Protein Domain Family
PRK13910

?
PRK13910: PRK13910 
DNA glycosylase MutY; Provisional
Statistics
?
PSSM-Id: 172427
View PSSM: PRK13910
Aligned: 9 rows
Threshold Bit Score: 515.727
Threshold Setting Gi: 108562565
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188526946   1 MSQQTQISTVVERFYSPFLEAFPTLKDLASAQLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHNSQLPNDYQSLLKLPGI 80 
109946935   1 MSQQTQINTVVERFYFPFLKAFPTLKDLANAQLEEILLLWRGLGYYSRAKNLKKSAEICAKEHHSQLPNDYQSLLKLPGI 80 
108562565  40 MSQQTQINTVIERFYSPFLEAFPTLKDLANAPLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHNSQLPNDYQSLLKLPGI 119
15611200   40 MSQQTQISTVIERFYPPFLKAFPTLKDLANAPLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHHSQLPNDYQSLLKLPGI 119
15644772   40 MSQQTQINTVIERFYSPFLEAFPTLKDLANAQLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHHSQLPNDYQSLLKLPGI 119
210134342   1 MSQQTQINTVVERFYSPFLEAFPTLKDLANAQLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHHSQLPNDYQSLLKLPGI 80 
208434098   2 MSQQTQINTVVERFYSPFLEAFPTLKDLANAPLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHNSQLPNDYQSLLKLPGI 81 
254778858   2 MSQQTQINTVVERFYSPFLEAFPTLKDLANAPLEEVLLLWRGLGYYSRAKNLKKSAEICVKEHHSQLPNDYQSLLKLPGI 81 
298736914  40 MSQQTQISTVIERFYSPFLKAFPTLKDLANAPLEEVLLLWRGLGYYLRAKNLKKSAEICVKEHNSQLPNDYQSLLKLPGI 119
188526946  81 GAYTANAILCFGFREKSACVDANIKRVLLRLFGLDPNITAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAIC 160
109946935  81 GVYTANAILCFGFRKKTACVDANIKRALLRLFGLDPNIQAKDLQRKANNFLNLNESFNHNQALIDLGALICSPKPKCAIC 160
108562565 120 GAYTANAILCFGFREKSACVDANIKRTLLRLFGLNPNITAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCTIC 199
15611200  120 GAYTANAILCFGFREKSACVDANVKRVLLRLFGLDPNIHAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAIC 199
15644772  120 GAYTANAILCFGFREKRACVDANIKRVLLRLFGLDPNIHAKDLQIKANEFLNLNESFNHNQALIDLGALICSPKPKCAIC 199
210134342  81 GAYTANAILCFGFREKSACVDANIKRVLLRLFGLDPNIHAKDLQIKANDFLNPNESFNHNQALIDLGALICSPKPKCAIC 160
208434098  82 GTYTANAILCFGFREKSACVDANIKRVLLRLFGLDPNITAKDLQIKANDFLNPNESFNHNQALIDLGALICSPKPKCAIC 161
254778858  82 GAYTANAILCFGFREKSACVDANIKRVLLRLFGLDPNIHAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAIC 161
298736914 120 GTYTANAILCFGFREKSACVDANIKRALLRLFGLDPNTTAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAIC 199
188526946 161 PLNPYCLGKNHPEKHTLKKKQEIIQEERYLGVVIQNNQIALEKIEQKLYFGMHHFPNLKENLEYKLPFLGTIKHSHTKFK 240
109946935 161 PLNPYCLGKNHLEKHTLKKKQEIIQEERYLGVVIKNNKIALEKIEQKLYFGMHHFPNLKENLEFKLPFLGVIKHSHTKFK 240
108562565 200 PLNPYCLGKNNPEKHTLKKKQEIVQEERYLGVVIQNNQIALEKIEQKLYLGMHHFPDLKENLECKLPFLGAIKHSHTKFK 279
15611200  200 PFNPYCLGKNHLERHTLKKKQEIIQEERYLGVVIQNNQIALEKIEQKLYLGMHHFPNLKENLEFKLPFLGTIKHSHTKFK 279
15644772  200 PFNPYCLGKNHLEKHTLKKKQEIIQEERYLGVVIQNNQIALEKIEQKLYLGMHHFPDLKENLECKLPFLGAIKHSHTKFK 279
210134342 161 PFNPYCLGKNNPEKHTLKKKQEIVQEERYLGVVIQNNQIALEKIEQKLYFGMHHFPNLKENLEFKLPFLGAIKHSHTKFK 240
208434098 162 PFNPYCLGKNNPEKHTLKKKQEIVQEERYLGVVIQNNQIALEKIEQKLYLGMHHFPNLKENLEYKLPFLGAIKHSHTKFK 241
254778858 162 PLNPYCLGKNNPEKHTLKKKQEIVQEERYLGVVIQNNQIALEKIEQKLYLGMHHFPNLKENLEYKLPFLGAIKHSHTKFK 241
298736914 200 PLNPYCLGKNNPEKHTLKKKQEIVQEERYLGVVIQNNQIALEKIEQKLYFGMHHFPNLKENLEYKLPFLGAIKHSHTKFK 279
188526946 241 LNLNLYLAAIKDLKNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGG 289
109946935 241 LNLNLYLAAAKDLKNPINFYSLKDLETLPISSMTLKILNFLKHKNLFGS 289
108562565 280 LHLNLYSAAIKDLKNPIRFYSLKDLETLPISSMTLKILHFLKQKNLFGG 328
15611200  280 LNLNLYLATTKDLKNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGG 328
15644772  280 LHLNLYSAAIKDLKNPVRFYSLKDLETLPISSMTLKILNFLKQKNLFGG 328
210134342 241 LNLNLYLATTKDLKNPVRFYSLKDLETLPISSMTLKILHFLKQKNLFGG 289
208434098 242 LNLNLYLAAIKDLKNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGG 290
254778858 242 LNLNLYLAAIEDLRNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGG 290
298736914 280 LNLNLYLATTKDLKNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGS 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap