Conserved Protein Domain Family
rnhA

?
PRK13907: rnhA 
ribonuclease H; Provisional
Statistics
?
PSSM-Id: 139967
View PSSM: PRK13907
Aligned: 20 rows
Threshold Bit Score: 272.695
Threshold Setting Gi: 152975120
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49477289    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
42780788    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSFPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
30019744    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSVPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80 
163939500   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
218233881   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSVPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80 
218896627   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSLPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80 
227815554   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
225863552   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
229601488   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
301053232   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLTALKYCTEHNYNIVSFRTDSQLVERAVEKE 80 
49477289   81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
42780788   81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
30019744   81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
163939500  81 YAKNKIFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
218233881  81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
218896627  81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
227815554  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
225863552  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
229601488  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
301053232  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap