Conserved Protein Domain Family
ruvA

?
PRK13901: ruvA 
Holliday junction branch migration protein RuvA
Statistics
?
PSSM-Id: 139961
View PSSM: PRK13901
Aligned: 8 rows
Threshold Bit Score: 286.719
Threshold Setting Gi: 203287496
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15594369    1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFNLSDKVELFTYLYTRENELKLFGFLNSDEREIFKELIGVSGV 80 
187917906   1 MINKIYGKIIEKRESSIVIVALPFEFEVLVSSFCNAELRLLEDVEILTYLHLREDEIKLFGFLNVSEREVFEELISVDGI 80 
51598286    1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFKLSDKVELFTYLYARENELKLFGFLNSDERETFKSLIGVSGI 80 
111114845   1 MINKIYGKVIEKKESSLVLMTAVFEFELLVSAFCLANFKLLDKVELFTYLYTKENELKLFGFLNSDERETFKSLIGVSGI 80 
119952829   1 MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDVEILTYLHLREDEIRLFGFLNVSEREVFEKLISVDGI 80 
203283953   1 MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVEILTYFHFRDDDVKLFGFLNISEREVFEDLIGVDGI 80 
203287496   1 MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVEILTYFHFRDDDVKLFGFLNISEREVFENLIGVDGI 80 
218249661   1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFNLSDKVELFTYLYTRENELKLFGFLNSDEREIFKELIGVSGV 80 
15594369   81 GPRAALRVLSNIRYNEFKEAIDKEDIELVSKIKGIGKKMAGKMFLHLQGKLLINSELEStGLFRFKELEESIVSMGFDRK 160
187917906  81 GPRAALRMLSGMKYDEFRDAIEREDVKRISTVKGIGNKVAGKIFLKLRGKLVKADELTS-SVFKFKDLEQSIVNMGFDRK 159
51598286   81 GPRAALRVLSNIRYNDFKEAIDREDVELVSKIKGIGKKMAGKMFLHLQGKLLINNELES-SLFGFKELEESIVSMGFDRK 159
111114845  81 GPRAALRVLSNIRYNEFKDAIDREDIELIAKIKGIGKKMAGKMFLHLQGKLLINNELES-SLFRFKELEESIVSMGFDRK 159
119952829  81 GPKAALRILSGIKYNEFRDAVEREDVKLISNVKGIGNKMAGKIFLKLRGKLVKVNEASS-GVLKFKELEQSIVNMGFDRK 159
203283953  81 GPKAALKILSGIKYDAFRLAIAKEDINLISKVKGIGNKIAGKIFLKLRGKLVKGDESSS-YMLKFKELEQSIVNMGFDRK 159
203287496  81 GPKAALKILSGIKYDAFRLAIAKEDINLISKVKGIGNKIAGKIFLKLRGKLVKGDESSS-YMLKFKELEQSIVNMGFDRK 159
218249661  81 GPRAALRVLSNIRYNEFKEAIDKEDIELVSKIKGIGKKMAGKMFLHLQGKLLINSELEStGLFRFKELEESIVSMGFDRK 160
15594369  161 IVNSKIREAFNLAEFANLKDSEKEQFLFKEVLKRISN 197
187917906 160 LVVAAIKEIMLIDEFLMLREVEQEQFLFRETLKRLSG 196
51598286  160 IVNSKLKEACDLIEFSNLKDSEKEQFLFKEVLKRMSN 196
111114845 160 IVNSKLKEAFNLVEFSNLKDSEKEQFLFKEVLKRMSN 196
119952829 160 LVAAAIKEIMLIDEFLMLRQVDQEQFLFREILRKLSG 196
203283953 160 LVVVAFREIMLSDKFLILKEAEQEQFLFTETLKRLSV 196
203287496 160 LVVVAFREIMLSDKFLILKEAEQEQFLFTETLKRLSV 196
218249661 161 IVNSKIREAFNLAEFANLKDSEKEQFLFKEVLKRISN 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap