Conserved Protein Domain Family
PRK13898

?
PRK13898: PRK13898 
type IV secretion system ATPase VirB4; Provisional
Statistics
?
PSSM-Id: 172418
View PSSM: PRK13898
Aligned: 30 rows
Threshold Bit Score: 1523.54
Threshold Setting Gi: 148285050
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157826563   1 MKLFRTRAANELRAKQDRPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNALLKNMASGNI 80 
88608419    2 FDFAVFKNYKAKVASSEYHARNFVPYKDHLDSSTILLKDNSMLKVIRLVGYPFETADDEDVDIHKALRNQLFKSVSSGHF 81 
42520693    2 LRFRAIQSKNKSTLNREVHAAEFIPYSCYWNSTTLMTKENWLVKVIKLSGFAFETADDEDLVIQNNIRNQMLRSISSPAF 81 
58585054    2 LKFRAIQSKNKSILSREVHAAEFIPYSCYWNSTTLITKQDWLVKFIKLSGFAFETADDEDLVIQNNIRNQMLRSISSPAF 81 
58617267    3 LKLNRLQTKKRKIIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQMLRSISSSSF 82 
57239252    2 LKLNRLQTKKRKIIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQMLRSISSSSF 81 
58579215    3 LKLNRLQTKKRKIIAREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQMLRSISSSSF 82 
73667151    2 LKFQQLQTKRRKVINREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDEDLSIQNSIRNQMLRSISSASF 81 
190571011   2 LRFRAIQSKNKSILSREVHAAEFIPYSCYWNSTTLITKQNWLVKFIKLNGFAFETADDEDLVIQNNIRNQMLRSISSPAF 81 
225630562   2 LRFRAIQSKNKSTLNREVHAAEFIPYSCYWNSTTLMTKENWLVKVIKLSGFAFETADDEDLVIQNNIRNQMLRSISSPAF 81 
157826563  81 VVYFHTIRRRKAVIFDDTeftydPTVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILYKPDTGGAAIVEYFLKKLRQK 160
88608419   82 ALSFHLIRRREGSQARAL-----FSNKIPNYFADYVRKRWRQKHGNKSSFVNELYITVVRRNDKK-VELFNDLYRKVTRK 155
42520693   82 SLYFHTIRRKKNIFSDEF-----ASQGLPNFFANHVNLKWREKHATRQSFINDLYITIIRRADTKGVEFLSHLLKKFGHV 156
58585054   82 GLYFHTIRRKKNIFSDEF-----ASQNFPNFFANHVNLKWREKHATRQSFINDLYITIIRRADTKGVEFLSHLLKKFGHV 156
58617267   83 GLYFHIIRRRRNAFTEGF-----ASDKVSSSFANYVNVKWREKHATKQSFTNDLYITIVREGGKKGMEFLSSILDKFGKG 157
57239252   82 GLYFHIIRRRRNAFTEGF-----ASDKVSSSFANYVNVKWREKHATKQSFTNDLYITIVREGGKKGMEFLSSILDKFGKG 156
58579215   83 GLYFHIIRRRRNAFTEGF-----ASDKVSSSFANYVNVKWREKHATKQSFTNDLYITIVREGGKKGMEFLSSILDKFGKG 157
73667151   82 GLYFHIIRRRRNAFSEGF-----ASDKVASSFANYVNVKWREKHETKQSFTNDLYITIVRESGKQGVEFLSSIFGKFGKV 156
190571011  82 SLYFHTIRRKKNIFSDEF-----ANQSLPNFFANHVNLKWREKHATRQSFINDLYITIIRRADTKGVEFLSHLLKKFGHV 156
225630562  82 SLYFHTIRRKKNIFSDEF-----ASQGLPNFFANHVNLKWREKHATRQSFINDLYITIIRRADTKGVEFLSHLLKKFGHV 156
157826563 161 SNKNVWENDMKEMKENLQEMSNRIVNTFRSYGARILGVRKTPTGNYCEMLEFLSSLVNCGDSPGPVALPRSTIDEYLPTH 240
88608419  156 DTKEGRIADLKIAHEELEEMTNKLLVSLRNNTPHLLGLKKVGNVTYSEVLAFLSGIANCGVAQSDFVLPYGPLDEALCGC 235
42520693  157 TSKHAWESDIRATYEDLEETTNRVVTSLRNYSPKILGVKETPDGLFCEIMEFLSRIVNCGFVTNTLFPLRTEISRYLPVH 236
58585054  157 TSKHAWESDMRATYEDLEETTNRVMTNLRSYSPKILGVKETPNGLFCEIMEFLSRIVNCGFITNTLLPLKTEISRYLPVH 236
58617267  158 AAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILGIRETKHGVFSEIMEFLLQIVNCGSFQ-YALFPLGDVSRYLPMH 236
57239252  157 AAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILGIRETKHGVFSEIMEFLLQIVNCGSFQ-YALFPMGDVSRYLPMH 235
58579215  158 AAQEARMKDLHAISEDLDEVTNRVFTSLRNYMPKILGIRETKHGVFSEIMEFLLQIVNCGSFQ-YALFPMGDVSRYLPMH 236
73667151  157 ASQESWIKDLQAIYEDLDEVTNRVFTSLRNYMPRVLGIRETPKGVFSEIMEFLLQIVNCGSFQ-RVLFSIGDVSKYLPMH 235
190571011 157 TSKHAWESDMRDTYEDLEETTNRIVTSLRNYSPKVLGVKETPNGLFCEIMEFLSRVVNCGFVTNTLFPLKTEISRYLPVH 236
225630562 157 TSKHAWESDIRATYEDLEETTNRVVTSLRNYSPKILGVKETPDGLFCEIMEFLSRIVNCGFVTNTLFPLRTEISRYLPVH 236
157826563 241 RLFFDSRTIEARSSIGTKYAGIISILEYGPTTSAGIFDGFLQMPFEFVMTQSFIFANRTVAIGKMQLQQNRMIQAGDKAT 320
88608419  236 RMYFGRKSIEIVTPSRSEYAGIISLKEYGQNTSAGMLDNFLQVPYELVITQTFQFVHRQVAISKMQVQQSRMLQTQDKAI 315
42520693  237 RLFFGRKMIQVVTHNESKYAGIISIKEYGNHTSAGMLDSFLQLPYEFIITQSFQFINRQMAIGKMQIQQNRMIQSADKAI 316
58585054  237 RLFFGRKMIQVVTHNESKYAGIVSIKEYGNNTSAGMLDHFLQLPYEFIITQSFQFTNRQMAIAKMQIQQNRMIQSADKAI 316
58617267  237 RLYFGHKTIQIVGHNECKYAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDKAV 316
57239252  236 RLYFGHKTIQIVGHNECKYAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDKAV 315
58579215  237 RLYFGHKTIQIVGHNECKYAGLISLKEYGQTTSAGMLDAFLQLPYELIITQSFRFTNRQSAITKMQIQQNRMIQSSDKAV 316
73667151  236 RLYFGHKTIQIVAHNECKYAGLISLKEYGQSTSAGMLDAFLQLPYEFIITQSFSFTNRQSAITKMQIQQNRMIQSADKAV 315
190571011 237 RLFFGHKMIQVVTHNESKYAGIVSIKEYGNNTSAGMLDSFLQLPYEFIITQSFQFTNRQMAIAKMQIQQNRMIQSADKAI 316
225630562 237 RLFFGRKMIQVVTHNESKYAGIISIKEYGNHTSAGMLDSFLQLPYEFIITQSFQFINRQMAIGKMQIQQNRMIQSADKAI 316
157826563 321 SQIAEISTALDMATSGDIGFGEHHLSLLCSANSIKALEDILSMASVELSNSGIQPVREKINMEPSYWGQLPGNMEYIVRT 400
88608419  316 SQVAEITRALDDAMSGRIAFGLHHLTILCREKTEKGLENALSLVESELTNAGVYAVREKINLEPAFWAQLPGNFDYIVRK 395
42520693  317 SQIAEISQALDDAMSGKIAFGQHHLTILCIEKSPKSLDNALSLVESELSNCGVYPIRERVNLEPAFWAQIPGNFDYIVRK 396
58585054  317 SQIAEISHALDDAMSGRIVFGEHHLTILCIEKSPKSLDNALSFVESELSNCGVYPIREKVNLEPAFWAQVPGNFDYIVRK 396
58617267  317 SQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVREKINLEPAFWAQLPGNFEYVVRK 396
57239252  316 SQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVREKINLEPAFWAQLPGNFEYVVRK 395
58579215  317 SQVVEISQALDDATSGRIAFGQHHLTILCAEKNLKTLDNALSLIESELSNCGVYPVREKINLEPAFWAQLPGNFEYVVRK 396
73667151  316 SQVVEISQALDDAMSGRIAFGQHHLTILCTERSLKTLDNALSLIESELSNCGVYPVRERINLEPAFWAQLPGNFEYIVRK 395
190571011 317 SQIAEISHALDDAMSGKIAFGEHHLTILCIEKSPKSLDNALSLVESELSNCGVYPVRERVNLEPAFWAQIPGNFDYIVRK 396
225630562 317 SQIAEISQALDDAMSGKIAFGQHHLTILCIEKSPKSLDNALSLVESELSNCGVYPIRERVNLEPAFWAQIPGNFDYIVRK 396
157826563 401 STINTLNMASFASQHNYPIGKVRNNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKP 480
88608419  396 ATISTLNLAGFASQHNYPFGKMEGNHWGDAITVFDTTSGTPFYFNFHCKDVGHTLIIGPTGAGKTVLLNFLCAQSMKFRP 475
42520693  397 ATISSLNLAGFASQHNYPTGNKFNNHWGDAVTVFDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSP 476
58585054  397 GTISSLNLAGFVSQHNYPTGNKFNNHWGDAVTVFDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSP 476
58617267  397 AIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTSGTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSP 476
57239252  396 AIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTSGTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSP 475
58579215  397 AIISTLNMAGFASQHNYPVGKKFNNHWGEAVTVFDTTSGTPFFFNFHIRDVGHTSIIGPTGGGKTVLMNFLCAQAMKFSP 476
73667151  396 AIISTLNMAGFASQHNYPIGKKFNNHWGEAVTVFDTTSGTPFFFNFHIRDVGHTAIIGPTGGGKTVLMNFLCAQAMKFSP 475
190571011 397 GTISSLNLAGFASQHNYPTGKKFNNHWGDAVTVFDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSP 476
225630562 397 ATISSLNLAGFASQHNYPTGNKFNNHWGDAVTVFDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSP 476
157826563 481 RMFFFDKDRGAEIFIRALNGVYTVIDPGLKCNFNPLQLEDTSENRTFILEWLRVLVTSNGESITAQDNKILSQAVSGNFR 560
88608419  476 RMFFFDKDRGAEIFIRALGGIYTVIEPRSKSYFNPLQLDDTPENRTFLTEWLKILASVNGDKFTAADIATLNDAVAGNFK 555
42520693  477 RIFFFDKDRGAEIFLRALSGIYTVIEPRTKTNFNPLQLDDTSDNRTFLMEWIKSLISVYNDKFTSEDIARINDAIEGNFK 556
58585054  477 RIFFFDKDRGAEIFLRALGGIYTLIEPRTKTNFNPLQLDDTPDNRTFLMEWIKSLISVYNDKFTSEDITRVNDAIEGNFK 556
58617267  477 RIFFFDKDYGAEIFIRAIDGVYMVIEPRHLTGFNPLHLDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEGNFK 556
57239252  476 RIFFFDKDYGAEIFIRAIDGVYMVIEPRHLTGFNPLHLDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEGNFK 555
58579215  477 RIFFFDKDYGAEIFIRAIDGVYMVIEPRHLTGFNPLHLDDTPDNRTFLMEWIKSLISVFNDKLTSEDITRINDAIEGNFK 556
73667151  476 RIFFFDKDYGAEIFIRALSGVYMIVEPRNPTGFNPLQLDDTPDNRTFLMEWMKSLISVFNDKFTSEDITRINDAIEGNFK 555
190571011 477 RIFFFDKDRGAEIFLRALGGIYTIIEPRTKTNFNPLQLDDTPDNKTFLMEWIKSLILVYNDKFTSEDIARINDAIEGNFK 556
225630562 477 RIFFFDKDRGAEIFLRALSGIYTVIEPRTKTNFNPLQLDDTSDNRTFLMEWIKSLISVYNDKFTSEDIARINDAIEGNFK 556
157826563 561 LEKKDRRLSNVVAFLGIDTPDSLASRIAMWVGNGSHAKVFDNEVDDIDLQKARVFGFDMTELLKDPISLAPVLLYIFHRI 640
88608419  556 LDKADRTLSNLSAFFGLEGDNSLATRLLMWYGNGSHATLFDNQEDCLDFSKASVFGFEMGHLLRDSAALAPVLQYLFHRI 635
42520693  557 LRKEDRFLRNLVPFLGLAGPDTLAGAISMWHDNGSHAAIFDNKEDLLDFSRARVFGFEMASLLKDPVALGPVLIYLFHRI 636
58585054  557 LRKEDRFLRNLVPFLGLAGSDTLAGAISMWHGNGSHAAIFDNKEDLLDFSKARVFGFEMASLLKDPIALGPVLIYLFHRI 636
58617267  557 LKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGFEMSHLLKDPVSLAPVLLYLFHRI 636
57239252  556 LKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGFEMSHLLKDPVSLAPVLLYLFHRI 635
58579215  557 LKKEHRVLSNLVPFLGLDGPNTLAGAISMWHSDGSHAAIFDNKEDLLDFNKSRVFGFEMSHLLKDPVSLAPVLLYLFHRI 636
73667151  556 LKKEHRVLCNLVPFLGLDGPNTLAGSISMWHSKGSHAAIFDNAEDLLDFNKSRVFGFEMGHLLKDPVSLAPVLLYLFHRI 635
190571011 557 LKKEDRFLRNLVPFLGLAGPDTLAGAISMWHDDGSHSAIFDNKEDLLDFSKARVFGFEMASLLKDPVALGPVLIYLFHRI 636
225630562 557 LRKEDRFLRNLVPFLGLAGPDTLAGAISMWHDNGSHAAIFDNKEDLLDFSRARVFGFEMASLLKDPVALGPVLIYLFHRI 636
157826563 641 NISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAAKSRISDTLIQQTATQIFLPNLKATDI 720
88608419  636 SISLDGSPSMIVLDEAWALIDNPVFAPTIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATDV 715
42520693  637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNAFVIFATQSVEDASKSTISDTLVQQTATQIFLPNLKATSV 716
58585054  637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNAFVVFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSI 716
58617267  637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSA 716
57239252  636 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSA 715
58579215  637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSA 716
73667151  636 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSA 715
190571011 637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNAFVVFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSV 716
225630562 637 SISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNAFVIFATQSVEDASKSTISDTLVQQTATQIFLPNLKATSV 716
157826563 721 YRSAFMLSQREYILIKTTDPTTRYFLVKQGVDAVVAKVNLDGMNNIISVLSGRVETVILLDQIREKYGNDPEKWLPIFYE 800
88608419  716 YRSVFMLSEREYMLIKHTDPATRFFLIKQAMSAVIARINLSGMEDIISVLSGRADTVLLLHRIMEEYGEEPVKWLPVFYE 795
42520693  717 YRDVFMLTEREYILIKHTDPSTRFFLVKQGVNAVVARIDLKGLDDIINVLSGRAESVLLLHDILNEVGDNPKVWLPIFYQ 796
58585054  717 YRNVFMLTEREYILIKHTDPSTRFFLVKQGINAVVARIDLKGLDDIVNVLSGRAESVILLHDILKEVGDDPKVWLPIFYQ 796
58617267  717 YRNVFMLTEREYTLIKHTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWLPIFYE 796
57239252  716 YRNVFMLTEREYTLIKHTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWLPIFYE 795
58579215  717 YRNVFMLTEREYTLIKHTDPSTRFFLVKQGVSAVIARINLSGLEDIISVLSGRTETVLMLHDLIKEVGDDPNVWLPIFYE 796
73667151  716 YRNVFMLTEREYTLIKHTDPSTRFFLVKQGVSAVVARINLSGLEDVISVLSGRAETVLMLRDLIKEVGDDPNTWLPIFYE 795
190571011 717 YRDVFMLTEREYILIKHTDPSTRFFLVKQGVNAVVARIDLKDLDDVVNVLSGRAESVLLLYDILKEVGDDPKMWLPVFYQ 796
225630562 717 YRDVFMLTEREYILIKHTDPSTRFFLVKQGVNAVVARIDLKGLDDIINVLSGRAESVLLLHDILNEVGDNPKVWLPIFYQ 796
157826563 801 AVKTL 805
88608419  796 KVKEL 800
42520693  797 KVKNV 801
58585054  797 KVKNV 801
58617267  797 RAKYV 801
57239252  796 RAKYV 800
58579215  797 RAKYV 801
73667151  796 RVKHV 800
190571011 797 KVKNV 801
225630562 797 KVKNV 801
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap