Conserved Protein Domain Family
PRK13871

?
PRK13871: PRK13871 
conjugal transfer protein TrbC; Provisional
Statistics
?
PSSM-Id: 172391
View PSSM: PRK13871
Aligned: 7 rows
Threshold Bit Score: 183.553
Threshold Setting Gi: 159161956
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222109065   1 MSRKTQITLALAALAAFSwISIVNPAFASSGGGGLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFGGELNDFARR 80 
190014720   1 MSRKISILFTAATLVAIS-IGFTDSALASSGGGGLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFGGELNDFARR 79 
159161956   1 MSHKIRIAIALAAFAAGSfIGLADPAFASS-GGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFGGELNDFARR 79 
10955103    1 MSLKTHHTPIFTALALVA-LGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFGGELNDFARR 79 
10954836    1 MSHKIRIAIALAAFAAVSfIGLADPAFASS-GGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFGGELNDFARR 79 
222083321   1 MSHKTRITVALAAFAAISsVILADPAFASS-GGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFGGELNDFARR 79 
222080319   1 MSRKTHLILTVTALALVS-LGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFGGELNDFARR 79 
222109065  81 LCYVALVGGVLLGATQIVALFGATGASIGEFEGRAGSWNVELSSELRTEGEGAHG 135
190014720  80 LCYVALVGGVLLGATQIVALFGATGASIGEAQAQAEQNTPEPTMTPATVVEGAHG 134
159161956  80 LCYVALVGGVLLGATQIIALFGATGASIGEMEARTGPGIIEPVM-LRAQGEGAHG 133
10955103   80 LCYVALVGGVLLGATQIVALFGATGASIGELHSQVDPFGYSPSPKLIERGEGAHG 134
10954836   80 LCYVALVGGVLLGATQIIALFGATGASIGEMEARTGPGIIEPVM-LRAQGEGAHG 133
222083321  80 LCYVALVGGVLLGATQIVALFGATGASIGEIEARTRSGIAEQSATLRPEGEGAHG 134
222080319  80 LCYVALVGGVLLGATQIVALFGATGASIGELHSQAGPFDYSPSATLIERGEGNRG 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap