Conserved Protein Domain Family
PRK13870

?
PRK13870: PRK13870 
transcriptional regulator TraR; Provisional
Statistics
?
PSSM-Id: 172390
View PSSM: PRK13870
Aligned: 10 rows
Threshold Bit Score: 403.991
Threshold Setting Gi: 10955061
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10954936    1 MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQHKHTIAVTNYHRDWRSAYFENNFDKLDPVVKRAKSRK 80 
10955045    1 MQHWLDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHRQWQSTYFDKKFEALDPVVKRARSRK 80 
10955061    1 MQTWLEKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHREWQSVYFDKKFDTLDPVIKRARSRK 80 
16119952    1 MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQHKHTIAVTNYHRDWRSAYFENNFDKLDPVVKRAKSRK 80 
190014846   1 MQHWLDKLTDLAAIEGDECILKTGLADIAEHYGFTGYAYLHIQHRHITAVTNYHREWQSTYFDKKLVALDPVVKRARSRK 80 
222109041   1 MQHWLDKLTDLTAIEGDECILKTGLADVADHFGFTGYAYLHIQHKHIIAVTNYHHDWRSLYFDKKFDALDPVVKRARSRK 80 
222109015   1 MQHWLDKLTDLTAIEGDECILKTGLADVADHFGFTGYAYLHIQHKHIIAVTNYHHDWRSLYFDKKFDALDPVVKRARSRK 80 
222080291   1 ----MDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHPEWQSVYFDKKFDALDPVVKRARSRK 76 
222080193   1 -------MTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHPEWQSVYFDKKFDALDPVVKRARSRK 73 
222083272   1 MQHWLDRLTDLAAIQGDESILTQGLADLTQHFGFTGYAYLHIQHKHTIAVTNYHREWRSTYFDKHFDKLDPVVKRAKSRK 80 
10954936   81 QVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASERPAIDLDREIDAVAAAGAVGQLHARIS 160
10955045   81 HIFTWSGEHERPTLSKDERAFYDHASDFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAATIGQIHARIS 160
10955061   81 HIFTWSGEQEGPSLSKDERTFYALAADFGIRSGISIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAATIGQIHSRIS 160
16119952   81 HVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASERPAIDLDREIDAAAAAGAVGQLHARIS 160
190014846  81 HIFTWSGEQERPSLSRDERSFYARAADFGIRSGITIPIRTANGSMSMFTLASDKPVIDLDREIDAVAAASTIGQIHARIS 160
222109041  81 QVFAWSGEQERPALSKEERAFYAQAADFGIRSGITIPIRTANGSMSMFTLASERTAIPLDREIDAVAAAAAVGQLHARIS 160
222109015  81 HVFAWSGEQERPALSKEERAFYAQAADFGIRSGITIPIRTANGSMSMFTLASERTAIPLDREIDAVAAAAAVGQLHARIS 160
222080291  77 HIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAGTIGQIHARIS 156
222080193  74 HIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAGTIGQIHARIS 153
222083272  81 QVFAWSGEQDRARQSKEERAFYAHAADFGIRSGVTVPIKTANGSMSMFTLASEKPAIDLDREIDAVAAAAAVGQLHARIS 160
10954936  161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
10955045  161 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
10955061  161 FLRTTPTAEDAAWLDPKEATYSDGLPSAR------------------RWRRSLTSKELSTTASASSFAKP---- 212
16119952  161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
190014846 161 YLRTTPTAEDAAWLDPKEASYLRWIAVGMTMEEIADVEGVKYNSVRVKLREAMKRFDVHSKAHMIALAIRRKLI 234
222109041 161 FLRTSPTAEDAVWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDIRSKAHLTALAIRRKLI 234
222109015 161 FLRITPTAEDAVWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
222080291 157 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRRLI 230
222080193 154 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 227
222083272 161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEIADVEGIKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap