Conserved Protein Domain Family
PRK13867

?
PRK13867: PRK13867 
type IV secretion system effector chaperone VirE1
Statistics
?
PSSM-Id: 172388
View PSSM: PRK13867
Aligned: 6 rows
Threshold Bit Score: 108.064
Threshold Setting Gi: 16119804
Created: 9-Dec-2010
Updated: 17-Jun-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86359764   1 MAIIKLNANKTRPVSLPEEPREIhTEAFSINHRSNGFTSLDLEMIELENFVLRCPLPEENLAGRI 65 
190014786  1 MAIIKPHVNKNRTTSPIERPESL-IEEMSGSHPPSGFTNLDLAMIELEDFVHRCPLPEDNLAGQK 64 
16119804   1 MVIIKLNANKNMPVLAVEKPQEIhKEELSDHHQSNGFTSLDLEMIELENFVLHCPLPEENLAG-- 63 
10954982   1 MVIIKLNANKNMPVLAVEKPQEIhKEELSDHHQSNGFTSLDLEMIELENFVLHCPLPEENLAG-- 63 
10955162   1 MAIIKPHANKNRTTSPIERPESL-IEEMSGSNPPIGFTSLDLAMIELEDFVHRCPLPGDNLAGQK 64 
222080256  1 MAISELNVNKNMPVLSGEEPQKFhMEELSDNYQPNGFTSLDLDMIELENFVLQCPLPEDNLAG-- 63 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap