Conserved Protein Domain Family
PRK13866

?
PRK13866: PRK13866 
plasmid partitioning protein RepB; Provisional
Statistics
?
PSSM-Id: 172387
View PSSM: PRK13866
Aligned: 6 rows
Threshold Bit Score: 558.032
Threshold Setting Gi: 86359879
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190014727   1 MSRKDAIDTLFLKKQPATDRTSVDKSAVRVRTGAISAMGSSLQEMSEAVKAAARLQEQLAAGEAVVSLDPSMIDGSPIAD 80 
10955107   12 MSRKDAIDSLFLKKQPSTERPSIDKSAVRVRTGAISAMGSSLQVMAEGAKAASRLQDQLAAGETVVSLDPSMIDGSQITD 91 
10954840    1 MSRKDAIDTLFLKKQPATDRAAVDKSTARVRTGAISAMGSSLQEMAEGAKAAARLQDQLATGEAVVSLDPSMIDGSPIAD 80 
16119856   35 MSRKDAIDTLFLKKQPATDRAAVDKSTARVRTGAISAMGSSLQEMAEGAKAAARLQDQLATGEAVVSLDPSMIDGSPIAD 114
86359879    1 MSRKDSIDSLFLKK-PVATASSASKSSDRVRTGAISAMGSSLHEMAENAKQASKLQQQLAEGEAVISIETASIDTSKIVD 79 
222109069   1 MSRKDAIDSLFLKKQPATDRTAVDKSAVRVRTGAISAMGSSLQEMAEGAKAAARLQDQLAAGEAVVFLDPSMIDGSPIAD 80 
190014727  81 RLPADVDPKFELLEASISQDGQQVPILVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTDRELVVAQGRENLDR 160
10955107   92 RLPVDVDPKFDQLEASISQDGQQVPILVRPHPETTGRYQIVYGRRRLRAAANLRREVSAIVRNLTDRELVVAQGRENLDR 171
10954840   81 RLPSDVDPKFEQLEASISQEGQQVPVLVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTDCELVVAQGRENLNR 160
16119856  115 RLPSDVDPKFEQLEASISQEGQQVPVLVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTDCELVVAQGRENLNR 194
86359879   80 RIPIDVDPAFDALVESIAEHGQQVPILVRPNPQASGRFQIAYGRRRVKAAEKLGRPVRAIVRNLSDSQLYIAQGRENLDR 159
222109069  81 RLPADVDPKFEQLEASISQEGQQVPILVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTDRELVVAQGRENLDR 160
190014727 161 ADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGIPLNLATQIGPASKAGRSRWVALAEELGKPKAREA 240
10955107  172 ADLSFIEKAFFALRLEEAGFDRPTVIAALSTDKADLSRYIAVAKAIPLDLATQIGPASKAGRSRWVALAEGLANSKAADA 251
10954840  161 ADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGIPLNLATQIGPASKAGRSRWVALAEGLGKPKATDA 240
16119856  195 ADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGIPLNLATQIGPASKAGRSRWVVLAEGLGKPKATDA 274
86359879  160 KDLSFIEKAFFAKNLEDDGCDRPTIIAALVSDKADVSRYVAVARQVPEELVKLIGPAPKAGRARWMTLVEHLSSPAKLAT 239
222109069 161 ADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGIPLNLATQIGPASKAGRSRWVALAEGLGKAKATDA 240
190014727 241 IEAVLSLEHFKHSDSDARFTLIFNAVSKPPatAKVLKKVRAWSTPKGKKAATIRQEVGRTALIFDEKLVPTFGEYVADKL 320
10955107  252 IGGVLESELFRTSDSDTRFSLVLKAVLKPA--VKPSKSVKAWSMPKGKKAAVIQKDTGRTALIFDEKLVPAFGEFVADQL 329
10954840  241 IEAMLGSEQFKQSDSDTRFNLIFNAVSRPP--AKTPKKVRAWSTPKGKKAATIRQETGRTALVFDERLVPTFGEYVADQL 318
16119856  275 IEAMLGSEQFKQSDSDTRFNLIFNAVSRPP--AKTPKKVRAWSTPKGKKAATIRQETGRTALVFDERLVPTFGEYVADQL 352
86359879  240 AHELVAGFAENRLQSDARLDALLRALSEPSk-KSRANRTDVWKTPLGKRAARVEAREGKTSITFEEKVVPAFGQFVSAKL 318
222109069 241 IEAVLESEQFKHSDSDARFALIFNAVSKPP--AKAPKKVRAWSTPKGKKAATIRQETGRTALVFDERLVPTFGEYVADQL 318
190014727 321 DSLYAQFLETTGGGKLDQ 338
10955107  330 DRLYAQFIETTDGEKLDQ 347
10954840  319 DSLYAQFIETNGGGKLDQ 336
16119856  353 DSLYAQFIETNGGGKLDQ 370
86359879  319 DQLYKEFQELNGDGD-ER 335
222109069 319 DSLYAQFIETTGGGKLDQ 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap