Conserved Protein Domain Family
PRK13865

?
PRK13865: PRK13865 
type IV secretion system protein VirB8; Provisional
Statistics
?
PSSM-Id: 172386
View PSSM: PRK13865
Aligned: 10 rows
Threshold Bit Score: 371.933
Threshold Setting Gi: 148244030
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148244030   3 ADMKNTALPIDNERLAAYFQDVESFQATEKRTARRWGRVGWVVAGVSLAVNVTLAGAIVMILPLEKLVPAFIIVKSDGTT 82 
150378119   1 MKSAEHALLVERGALAAHYIEVEAFQTSRAKSARRLSRVLVVIATAAVFGNIAQAFTIATMVPLAKLVPVYLWVRPDGTV 80 
190404472   1 MNGSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAVIAVAGNVAQAFAIAVMLPLNKLVPVYLWVRPDGTV 80 
190014774   1 MTGPEYAMLVARESLAEHYKEVEAFQTARAKSARRLSKLIAAVAAIAILGNVAQAFAIATMVPLSRLVPVYLWIRPDGTV 80 
86359754   21 MKGSDYALLVGREKLAEHYKEVEAFQTARAKSARRLSRVAAVVAAVATLGNVAQAFTIATMVPLTRLVPVYLWIRPDGTV 100
41223309    1 MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPVYLWIRPDGTV 80 
10954806    1 MNGSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAVIAVAGNVAQAFAIAVMLPLNKLVPVYLWVRPDGTV 80 
10954968    1 MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPVYLWIRPDGTV 80 
10955150    1 -------MLVARESLAEHYKEVEAFQTARAKSARRLSKIIAAVAAIAILGNVAQAFAIATMVPLSRLVPVYLWIRPDGTV 73 
222080242   1 MIDSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAIIAVAGNLAQAFAIAVMVPLNKLVPVYLWVRPDGTV 80 
148244030  83 STTMNFNSLPSDEKAAMTRAAIWQYVRARESYDFADAQYRYDVASLMSNPTVQGTYQSWFldKGPGSTSPQVTVGKKGQI 162
150378119  81 DSEVSVSRLPATQEQAVINASLWQYVRLREGYTADTAQYAYDLVSSFSAPSVRLEYQHHF--NYPNPTSPQVTIGEGGRL 158
190404472  81 DSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDLVSSFSAPTVRQDYQQFF--NYPSPSSPQTIIGKRGKL 158
190014774  81 DSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPTVRQDYQQFF--NYPNPSSPQVILGKRGRV 158
86359754  101 DSEVSVSRLPATQEKAVVNASLWEYVRMRESYTADTAQYAYDLVSNFSAPAVRQDYQQFF--NYPNPGSPQVVVGKRGRL 178
41223309   81 DSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFF--NYPNPTSPQVILGKHGRL 158
10954806   81 DSEVSISRLPATQEQAVVNASLWEYVRLRESYSADTAQYAYDLVSSFSAPTVRQDYQQFF--NYPSPSSPQTIIGKRGKL 158
10954968   81 DSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFF--NYPNPTSPQVILGKHGRL 158
10955150   74 DSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPTVRQDYQQFF--NYPNPSSPQVILGKRGRV 151
222080242  81 DSEVSVSRLPATQEQAVVNASLWEYVRLRESYTSDTAQYAYDLVSSFSAPTVRQDYQQFF--NYPSPSSPQTIIGKRGKL 158
148244030 163 SVAMVSMSMVRPNVALVRFRRTVTMYGSVPQTSTWTATVGFENVATLPVSARLADPSGLIVTNYQAQKDSP 233
150378119 159 DVEHISSNDIATGVQQIRFNRTLMMDGQTPVMSTWTATVRYEKVTSLSGESRLSNPGGLTVTSYQVSEDTV 229
190404472 159 EAEHIGSNELMTGVQQIRYKRTLIMEGQAPIVTTWTATVHYETVTNLPGRLRLTNPGGLIVTSYQTSEDTV 229
190014774 159 EVEHIASNDVTPSTQQIRYKRTLVVDGKMPVVSTWTATVRYEKVTSLPGRLRLTNPAGLVVTSYQTSEDTV 229
86359754  179 EVEHIASNDVAPGVQEIRYKRTLVIDSKMPVVSTWTATIHYEKVNSLPGRLRLTNPGGLVITSYQTSEDTV 249
41223309  159 EVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTV 229
10954806  159 EAEHIGSNELMPGVQQIRYKRTLIMEGQAPIVTTWTATVHYETVTNLPGRLRLTNPGGLIVTSYQTSEDTV 229
10954968  159 EVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTV 229
10955150  152 EVEHIASNDVTPSTQQIRYKRTLVVDGKMPVVSTWTATVRYEKVTSLPGRLRLTNPAGLVVTSYQTSEDTV 222
222080242 159 ESEHISSNELMPGVQQIRYKRTLTMEGQAPIVTTWTATVHYETVANLPGRLRLTNPGGLIVTSYQTSEDSV 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap