Conserved Protein Domain Family
PRK13862

?
PRK13862: PRK13862 
conjugal transfer protein VirC2
Statistics
?
PSSM-Id: 172383
View PSSM: PRK13862
Aligned: 9 rows
Threshold Bit Score: 274.81
Threshold Setting Gi: 116255015
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10954973    1 MGIRKPALSVGEARRLAAARPEIVHPSLPVATQNSTLPQPPENLDEEDRRPAPATAKRCHSSDQQSMLTVDALSSTTAPE 80 
10955155    1 MAIRKPALSVSEARRLAVARSEIHHPNPTLVPQELDLQHLPEKADEKDQQREPPVAEHIYSPDRQLKLTVDALSPPPSPK 80 
10954811    1 MGIRKPALSVGEARRLAAARP-IVHPIPALSSQNLAPSQLPERAGKEKRPAPPIAAKRRDNFDRQSMLTADALSSTAPPE 79 
86359759    1 MGIRKPALSVDEAKRLAAARPGIIHPDLQHFSRDAAAPRLPQRAGHEERRTTSALAKR-SGPESQSIRTVDALNSSTAPE 79 
116255015   1 MGIRKPAVSAQEARRLATSQSARSFQESMLASSNPRVAIAP--IEPTSRQTGDRTVPSQALPARRTVLLANERHDEDP-- 76 
159161999   1 MGIRKPALSVGEARRLAAARPEIVHPSLPVATQNSTLPQPPENLDEEDRRPAPATAKRCHSSDQQSMLTVDALSSTTAPE 80 
190014779   1 MAIRKPALSVGEARRLAGARPEIHHPNPTLVPQKLDLQHLPEKADEKDQQREPLVADHIYSPDRQLKLTVDALSPPPSPK 80 
190404479   1 MGIRKPALSVGEARRLAAARP-IVHPIPALSSQNLAPSQLPERAGKEKRPAPPIAAKRRDNFDRQSMLTADALSSTAPPE 79 
222080237   3 MGIHKPALSVGEAKRLAAARPEIVQTVPTRFSQGAQPPRLPERGRPLDRPL-PTAAKRRDNFDRQLVLTADALSSAAAPE 81 
10954973   81 KIQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAfEKSIIVQTSRMFPV 160
10955155   81 KLQVFLSARPPAPQVSKTYDNLVRQYSPSKSLQMILRRALDDFESMLADGSFRVALKSYPIPLTT-EKSVLVQTSRMFPV 159
10954811   80 KVQVFLSARPPAPEVSKIYDNLILQYSATKALQMILRRALADFENMLADGSFSTGPQSYPISKVV-EKPIVVLTSRMFPV 158
86359759   80 KVQVFLSARPPAPGVSEIYDSLILQYSASKSLQMILRRALDDFVTMLMDGSFSKASQSYPIPQETsEKRVIVQTSRMLPV 159
116255015  77 KVQVFLSAALPARGISATFDALSAESRPARALQLILRRALDDYELMLSNGSFAEIAQAYSVE----EPLSIVATSRMMPR 152
159161999  81 KIQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAfEKSIIVQTSRMFPV 160
190014779  81 KLQVFLSARPPAPQVSKTYDNLVRQYSPSKSLQMILRRALDDFESMLADGSFRVAPKSYPIPSTT-EKSVLVQTSRMFPV 159
190404479  80 KVQVFLSARPPAPEVSKIYDNLILQYSATKALQMILRRALADFENMLADGSFSTGPQSYPISKVV-EKPIVVLTSRMFPV 158
222080237  82 KIQIFLSARPPAPEVSKIYDTLILQYSASKSLQMILRRALADFESMLEDGSFSTAPKSYPISHVV-NKPIIVQTSRMFPV 160
10954973  161 SLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS 202
10955155  160 ALLEVARSHFDPLGLETTRAFGHKLATAALASFFAREKPSRN 201
10954811  159 SLLEVARNHFDPLRLETARAFGHKLATAALASFFAEEKIRKE 200
86359759  160 SALKIARDHFDPSGLETSRAFGLKLATAALASFFDAAKAPGR 201
116255015 153 RLVDIALAHFDPLGFNSARAFGRKLASSALCIFFNNEKKVTH 194
159161999 161 SLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS 202
190014779 160 ALLEVARSHFDPLGLETARAFGHKLATAALASFFAGEKPSSN 201
190404479 159 SLLEVARNHFDPLRLETARAFGHKLATAALASFFAEEKIRKE 200
222080237 161 SLLELARNHFDPLRLETARAFGHKLATAALASFFATEKTRKE 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap