Conserved Protein Domain Family
PRK13861

?
PRK13861: PRK13861 
type IV secretion system protein VirB9; Provisional
Statistics
?
PSSM-Id: 172382
View PSSM: PRK13861
Aligned: 10 rows
Threshold Bit Score: 468.191
Threshold Setting Gi: 148244031
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190404473   1 MIKNLFLGLVCILFVTSGANAEDTPAAGKLDPRMRYLAYNPDEVVHLSTAVGATLVVTFGSNEAVTAVAVSNSKDLAALP 80 
190014775   1 MIRKALFILACLFAAATGAEAEDTPMAGKLDPRMRYLAYNPDQVVRLSTAVGATLVVTFATNETVTAVAVSNSKDLAALP 80 
150378118   1 MITRTFLTIICLLCLAIAAHAEDTPAAGKLDPRMRYLAYNPDQVVRLSTAVGATLVVTFGASETVTAVAVSNSKDLAALP 80 
148244031   3 CARKLAASGFLWLGMMGTALAIQYPHPGHEDPRVRYVPYQSGNVTDIWTAPGAALTVQFGRNEKVVSVAESDSAYLKVVP 82 
86359755    1 MKKKELLTLACLLFAATGVMAEETPTPGRLDPRMRYLAYNPDQVVHLSTAVGATLVVSFAANETVTAVAVSNSKTLAALP 80 
16119791    1 MTKKAFLTLACLLFAAIGARAEDTPTAGRLDPRMRYLAYNPDQVVRLSTAVGATLVVTFGANETVTAVAVSNSKDLAALP 80 
10954807    1 MIKNLFLGLVCILFVTSGANAEDTPAAGKLDPRMRYLAYNPDEVVHLSTAVGATLVVTFGPNEAVTAVAVSNSKDLAALP 80 
10954969    1 MTKKAFLTLACLLFAAIGARAEDTPTAGRLDPRMRYLAYNPDQVVRLSTAVGATLVVTFGANETVTAVAVSNSKDLAALP 80 
10955151    1 MTRKALFILACLFAAATGAEAEDTPMAGKLDPRMRYLAYNPDQVVRLSTAVGATLVVTFATNETVTSVAVSNSKDLAALP 80 
222080241   1 MTKNLFLGLVCILFVTSGAKAEDTPAAGKMDPRMRYLAYNPDEVVHLSTAVGATLVVTFGPNETVTAVAVSNSKDLAALP 80 
190404473  81 RGNYLFFKASKVLQPQPVIVLT-ASDAGMRRYVFSLATRTMSRLDKEQPDLYYSVQFTYPA---DVAAARRKEAEQRDLA 156
190014775  81 RGNYLFFKASQVLTPQPVIVLT-ASDSGMRRYVFSISSKTLSHLDKEQPDLYYSVQFAYPA---DDAAARRREAQQKAVV 156
150378118  81 RGHYLFFKASQALPPQPVVVLT-ASEAGTRRYVFSISTKTMSQLTKEQPDLYYSVQFVYPA---DEAAARQKQAEKLSIV 156
148244031  83 VQNYLFIKPTGILPAQPIAVLCkTSDGKLRHYFFQF--ETVNKHLGAGENVDYAVVFTYPHqayERRLAKRKAAEAKAVQ 160
86359755   81 RGNYLFFKASQVLPPEPVVVLT-ASDAGMRRYVFSISSSTLAHLDKEQPDLYYSVQFAYPA---DEAAARRKEAQDKAAA 156
16119791   81 RGNYLFFKASKVLPPQPVVVLT-ASDAGMRRYVFSISSKTLPHLDKEQADLYYSVQFAYPA---DDAAARQKAAQEKAVA 156
10954807   81 RGNYLFFKASKVLQPQPVIVLT-ASDAGMRRYVFSLATRTMSRLDKEQPDLYYSVQFTYPA---DVAAARRKEAEQRDLA 156
10954969   81 RGNYLFFKASKVLPPQPVVVLT-ASDAGMRRYVFSISSKTLPHLDKEQADLYYSVQFAYPA---DDAAARQKAAQEKAVA 156
10955151   81 RGNYLFFKASQVLTPQPVIVLT-ASDSGMRRYVFSISSKTLSHLDKEQPDLYYSVQFAYPA---DDAAARRREAQQRAVV 156
222080241  81 RGNYLFFKASKVLQPQPVIVLT-ASDAGMRRYVFSLATKTMSRLDKEQSDLYYSVQFTYPA---DIAAARRKEAEQRDLA 156
190404473 157 DRMRAQAQYQRRAEDLLERPPAGGSTDAKNWSYVAQGDRSLLPLEVFDNGYSTTFRFPGNVRVPSIYVINPDGKEATANY 236
190014775 157 DRLHAEAQYQRKAENLLDQPVTALGAADSNWHYVAQGDRSLLPLEVFDNGFTTVFHFPGNVRIPSIYTINPDGKEAVANY 236
150378118 157 GRLRADAEYQQRAQHLLDQPAAIADSGANNFHYIAQGDRSLTPLEVFDNGVSTVFRFPGNVRIPSIYVINPDGKEATANY 236
148244031 161 KEARSRLD---EARAVMNAATVDQYQGPRNYEYVARGDHQLAPAEVWDNGYSTVFTFPAMQRIPAIFYVQPDGKEATANY 237
86359755  157 DRLRGEAQYQRRAADLLDQPATTGATGDRNWHYVAQGDRSLLPLEVFDNGFTTVFRFPGNVRIPSIYTIDPDGKEAVANY 236
16119791  157 DRIRAEAQYQQRAEGLLEQPATTVGAEDKNWHYVAQGDRSLLPLEVFDDGFTTVFHFPGNVRIPSIYTINPDGKEAVANY 236
10954807  157 DRMRAQAQYQRRAEDLLERPPAGGSTDAKNWSYVAQGDRSLLPLEVFDNGYSTTFRFPGNVRVPSIYVINPDGKEATANY 236
10954969  157 DRIRAEAQYQQRAEGLLEQPATTVGAEDKNWHYVAQGDRSLLPLEVFDDGFTTVFHFPGNVRIPSIYTINPDGKEAVANY 236
10955151  157 DRLHAEAQYQRKAEDLLDQPVTALGATDSNWHYVAQGDRSLLPLEVFDNGFTTVFHFPGNVRIPSIYTINPDGKEAVANY 236
222080241 157 GLMRAQAQYQRRAEDLLGRPAEGGDSGAKNWSYVAQGDRSLLPIEVFDNGFSTTFRFPGNVRVPSIYVINPDGKEATANY 236
190404473 237 SVKGDYVEVASVSREWRLRDGHTVLCIWNKAYDAVGRKPGTGTVRPDVVRVLKETR 292
190014775 237 SVKGSDVEISSVSRGWRLRDGHTVLCIWNTAYDPVGQRPQTGTVRPDVKRVLKGAK 292
150378118 237 SVKGDYVEVPAVAREWRLRDGHTVLGIWNSAYDPIGRKPGTGTVRHDVWRVLKGAS 292
148244031 238 SVNGNTVVVPGTAPEWRLRDGHTVLDIYDLKYNPTGATPGTHTISPDVEREMRTFN 293
86359755  237 SVKGSYVEISSVSSGWRLRDGNTVLCVWNTAYDPVGRRPDTGTVRPDVKRVLMEER 292
16119791  237 SVKGSYVEISSVSRGWRLRDGHTVLCIWNTAYDPVGRRPETGTVRPDVKRVLKEVR 292
10954807  237 SVKGDYVEVASVSREWRLRDGHTVLCIWNKAYDAVGRKPGTGTVRPDVVRVLKETR 292
10954969  237 SVKGSYVEISSVSRGWRLRDGHTVLCIWNTAYDPVGRRPETGTVRPDVKRVLKEVR 292
10955151  237 SVKGSDVEISSVSRGWRLRDGHTVLCIWNAAYDPVGQRPQTGTVRPDVKRVLKGAK 292
222080241 237 SVKGDYVEVASVSREWRLRDGHTVLCIWNKSFDVVGRKPGTGTVRPDVVRVLKEPR 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap