Conserved Protein Domain Family
PRK13860

?
PRK13860: PRK13860 
pilin minor subunit VirB5
Statistics
?
PSSM-Id: 172381
View PSSM: PRK13860
Aligned: 9 rows
Threshold Bit Score: 300.73
Threshold Setting Gi: 150378122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150378122   1 MKFTQLTVTTIAACLIMQAPARAQFVVTDPgntyqaaITAGTTILNYAKTAQMLEQTIAMVGMFTTNFAVTGLLSQINQG 80 
10955147    1 MKTTQLIATVLTCSFLYIQPARAQFVVSDP-------ATEAETLATALATAENLTQTIAMVTMLTSAYGVTGLLTSLNQK 73 
10954965    1 MKIMQLVAAAMAVSLLSVGPARAQFVVSDP-------ATEAETLATALETAANLEQTITMVAMLTSAYGVTGLLTSLNQK 73 
10954803    1 MNITKLAINALFICLVLSGTAKAQFVVSDP-------ATEAETLTTAINTAANLEQLITMVTMLTSPFGVTGMLSAIDQK 73 
16119787    1 MKIMQLVAAAMAVSLLSVGPARAQFVVSDP-------ATEAETLATALETAANLEQTITMVAMLTSAYGVTGLLTSLNQK 73 
86359751    1 MKMSRLVTAAVAGSLLSVVPARAQMVVSDP-------VADAETLATALATADNLAQTIAMVTMLTSAYGVTGLLTLLNQK 73 
190014771   1 MKTTQLIATVLTCSFLYIQPARAQFVVSDP-------ATEAETLATALATAENLTQTIAMVTMLTSAYGVTGLLTSLNQK 73 
190404469   1 MNITKLVINALFICLVLSGTAKAQFVVSDP-------ATEAETLTTAINTAANLEQLITMVTMLTSPFGVTGMLSAIDQK 73 
222080244   1 MKTAKLAINALFICLALSGSAKAQFVVSDP-------VTETETLTTALNTAANLEQLITMVTMLTAPFAVTGILSALDQK 73 
150378122  81 NKYPSTNKLSEQMFDSQRPVSATARAIATDRDRAIDGSDAHAELLRGQITGAANAASVAADNLELMDKRLRENGNTLGQL 160
10955147   74 NQYPSTKDLDNEMFSPRMPMSTTARAITSDTDRAVVGSDAEADLLRSQITGSANSAGIAADNLETMDKRLTANADTSAQL 153
10954965   74 NQYPSTRDLDTEMFSPRMPMSTTARAITTDTDRAVVGGDAEADLLRSQITGSANSAGIAADNLETMDKRLTANAETSTQL 153
10954803   74 NQYPSAGQLDKEMFSPQMPASTTARAITLDADRAVVGDDAEGNLLRQQIAGAANAAGVAADNLDAMDKRLAANSETSGQL 153
16119787   74 NQYPSTRDLDTEMFSPRMPMSTTARAITTDTDRAVVGGDAEADLLRSQITGSANSAGIAADNLETMDKRLTANAETSTQL 153
86359751   74 NQYPATRDLDTEMFSAQRPASTTARAIAGDADRTVTGSDAEADLLRSQITGAANSTGIAADNLEAMDKRLKANAETSAQL 153
190014771  74 NQYPSTKDLDNEMFSPRMPMSTTARAITSDTDRAVVGSDAEADLLRSQITGSANSAGIAADNLETMDKRLTANADTSAQL 153
190404469  74 NQYPSAGQLDKEMFSPQMPASTTARAITLDADRAVVGDDAEGNLLRQQIAGAANAAGVAADNLDAMDKRLAANSETSGQL 153
222080244  74 NQYPSAGELDKEMFSPKTPASTNARTITLDADRAVVGDDAEANLLRRQIAGAANAAGVAADNLDAMDKRLKANSETSAQL 153
150378122 161 SRSRNIMQATVTNGLLLKQIHDAIIQNSQATSLLTMATAQASLHAAEEAAAQRRERLETAKIFSPGL 227
10955147  154 SRSRNIMQATVTNGLLLKQIHDAMIQNVQATNLLTMATAQAGLHEAEEAAAQRKEHQKTAVIFGALP 220
10954965  154 SRSRNIMQATVTNGLLLKQIHDAMIQNVQATSLLTMTTAQAGLHEAEEAAAQRKEHQKTAVIFGAVP 220
10954803  154 SRSRNIMQATVTNGLLLKQIHDAIIQNIQATSLLTMTTAQAGLHEAEEAATQRKEHQATALIFGAAQ 220
16119787  154 SRSRNIMQATVTNGLLLKQIHDAMIQNVQATSLLTMTTAQAGLHEAEEAAAQRKEHQKTAVIFGAVP 220
86359751  154 SRSRNIMQATVTNGLLLKQIHDAAIQNVQATSLLTMTTAQAGLHAAEEAAEQRKEHQKTAAIFGALP 220
190014771 154 SRSRNIMQATVTNGLLLKQIHDAMIQNVQATSLLTMTTAQAGLHEAEEAAAQRKEHQKTAVIFGALP 220
190404469 154 SRSRNIMQATVTNGLLLKQIHDAIIQNIQATSLLTMTTAQAGLHEAEEAATQRKEHQATALIFGAAQ 220
222080244 154 SRSRNIMAATVTNGLLLKQIHDAIIQNIQATSLLTMTTAQTGLHETEEAATQRKEHQATALIFGAAQ 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap