Conserved Protein Domain Family
PRK13859

?
PRK13859: PRK13859 
type IV secretion system lipoprotein VirB7; Provisional
Statistics
?
PSSM-Id: 172380
View PSSM: PRK13859
Aligned: 9 rows
Threshold Bit Score: 88.3673
Threshold Setting Gi: 159161998
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190404471  1 MKYFLLFLIIGLASCQTSDQLATCKGPIFPLNVGRWQPAQSDLQPTNAGEANERL 55 
190014773  1 MKYCLLCLVVALSGCQTNDTLASCKGPIFPLNVGRWQPTPSDLQLGNSGGRYDGA 55 
150378120  1 MKYCSLILFLALAACKTSDTLATCKGAAFQLNVERWQPTASDLQFECTGEPNEER 55 
159161998  1 MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQLSNVGGRHEGV 55 
86359753   1 MKYCLLCLAIVLTGCQTNDKPASCKGPIFPLNVGRWQPAPSDLHPGMADGQHERV 55 
10954805   1 MKYFLLFLIIGLASCQTSDQLATCKGPIFPLNVGRWQPAQSDLQPTNAGEANERL 55 
10954967   1 MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQLSNVGGRHEGV 55 
10955149   1 MKYCLLCLVVALSGCQTNDTIASCKGPIFPLNVGRWQPTPSDLQLRNSGGRYDGA 55 
222080322  1 MKYFLLFLILGLASCQTSDQLATSKGPVFPLNVGRWQPTQSDLQLTNAGEANDRL 55 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap