Conserved Protein Domain Family
PRK13857

?
PRK13857: PRK13857 
pilin major subunit VirB2
Statistics
?
PSSM-Id: 172378
View PSSM: PRK13857
Aligned: 9 rows
Threshold Bit Score: 167.733
Threshold Setting Gi: 150378125
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190014768   1 MRCFERYRLHLNRLSLSNAMMRVISSCAPSLCGAIAWSISSSGPAAAQSAgGGTDPATMVNNICTFILGPFGQSLAVLGI 80 
150378125   1 MASLNKHRARLSPVAFLKAMSRTAVDHAPAAGGAAVWSIVCSGPATAQVT-GGTDPATMVNNICAFILGPFGQSLAVLGI 79 
190404466   1 MAWLEGYRAPSKFRGLWHRAVRLLAPHVPSVTGAIGWSLFFCEPAAAQAA-GGTDPATMVNNICTFILGPFGQSLAVLGI 79 
86359827    2 MRCFERYRVHLNRLSLSNAVMRLVSGYAPSVGGAMGWSMFSFGPAAAQSAgGGTDPATMVSNICTFILGPFGQSLAVLGI 81 
10954800    1 MAWLEGYRAPSKFRGLWHRAVRLLAPHVPSVTGAIGWSLFFCEPAAAQAA-GGTDPATMVNNICTFILGPFGQSLAVLGI 79 
10954962    1 MRCFERYRVHLNRLSLSNAVMRMVSGYAPSVVGAMGWSIFSSGPAAAQSAgGGTDPATMVNNICTFILGPFGQSLAVLGI 80 
10955144    1 MRCFERYRLHLNRLSLSNAMMRVISSCAPSLGGAMAWSISSCGPAAAQSAgGGTDPATMVNNICTFILGPFGQSLAVLGI 80 
16119783    1 MRCFERYRVHLNRLSLSNAVMRMVSGYAPSVVGAMGWSIFSSGPAAAQSAgGGTDPATMVNNICTFILGPFGQSLAVLGI 80 
222080247   1 MACFEKYPELSKIRDLRDRVVSLLVPHLPSVSGAIGWSLFFREPAAAQAA-GGTDPATMVNNICTFILGPFGQSLAVLGI 79 
190014768  81 VAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGS 121
150378125  80 VAIGISWMFGRASLGLVAGVIGGIVIMFGASFLGKALIGAG 120
190404466  80 VAIGVSWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGG 120
86359827   82 VAIGLSWMFGRASLGLIAGVVGGVVIMFGASFLGKTLTGGG 122
10954800   80 VAIGVSWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGG 120
10954962   81 VAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKTLTGGG 121
10955144   81 VAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGS 121
16119783   81 VAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKTLTGGG 121
222080247  80 VAIGVSWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGG 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap