Conserved Protein Domain Family
PRK13856

?
PRK13856: PRK13856 
two-component response regulator VirG; Provisional
Statistics
?
PSSM-Id: 172377
View PSSM: PRK13856
Aligned: 10 rows
Threshold Bit Score: 403.04
Threshold Setting Gi: 86751487
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16119794   13 LKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLCSETVDVVVVDLNLGREDGLEIVRSLATKSDVPIIIISG 92 
10955154    1 MKHVLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATVDVVVVDLNLGREDGLEIVRNLAAKSDIPIIIISG 80 
10954972   13 LKHVLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLCSETVDVVVVDLNLGREDGLEIVRSLATKSDVPIIIISG 92 
86359758    6 LKHVLVIDDDLAMRHLIVECLTVHALKVTAVADSQQFNRVLSSETVDVVVVDLNLGREDGLEIVRTLATKSDVPIIIISG 85 
86751487    1 MKHILVVDDDSRLRSMLVDYLTQHAFRASAAKDSHQLGQILANDPADLIIVDLNLGREDGLEIVRSHSTKSDAPIIIISG 80 
190014778  27 LKHVLLIDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATVDVVVVDLNLGREDGLEIVRNLAAKSDIPIIIISG 106
150378112   1 MKHVLVIDNDVAMRHLIEEYLTMHAFKVTALSDGGQLNRVLSCYPVDLVVLDLALGREDGLDIVRNLTSKTDIPVIVISG 80 
222080238   1 MKHVLVIDDDAAMRHLITEYLTIHALRVTAVSDSQQFNRVLASETVDVVVVDLNLGREDGLEIVRGLATKSDIPIIIISG 80 
228861207   1 MKHVLVIDDDAAMRHLITEYLTIHALRVTAVSDSQQFNRVLASETVDVVVVDLNLGREDGLEIVRSLATKSDVPIIIISG 80 
228861208   1 MKHVLVIDDDAAMRHLITEYLTIHALRVTAVSDSQQFNRVLASETVDVVVVDLNLGREDGLEIVRSLATKSDVPIIIISG 80 
16119794   93 ARLEEADKVIALELGATDFIAKPFGTREFLARIRVALRVRPSVARTKDRRSFSFADWTLNLRRRRLISEEGSEVKLTAGE 172
10955154   81 DRLEETDKVVALELGASDFIAKPFSIREFLARIRVALRVRPNVVRSKDRRSFCFTDWTLNLRQRRLMSEAGGEVKLTAGE 160
10954972   93 ARLEEADKVIALELGATDFIAKPFGTREFLARIRVALRVRPSVARTKDRRSFSFADWTLNLRRRRLISEEGSEVKLTAGE 172
86359758   86 DRLEEADKVLALELGATDFIAKPFGTREFLARIRVALRVRPTVARTKDRRTFYFDGWTLNLRQRRLTSEGGAEVKLTAGE 165
86751487   81 DRLDEADKVVGLELGASDYITKPFGLREFVARIRAALRVKSPAV-LPDRSIYRFGDWMLNAKRRQLASRAAGEVKLTAAE 159
190014778 107 DRLEETDKVVALELGASDFIAKPFSTREFLARIRVALRVRPNVVRSKDRRSFCFTDWTLNLRQRRLMSEAGGEVKLTAGE 186
150378112  81 DRLEETEKVVALELGATDFVPKPFGMREFLARIRVGLRQRAVIPRTKDRRSFYFAGWTLNLKQRRVISEQRGELKLTAGE 160
222080238  81 DRLEEADKVVALELGATDFIAKPFGTREFLARIRVALRVRPNVMRTKDRRSFCFAGWTLSLRQRRLTSTDNGEVKLTAGE 160
228861207  81 DRLDEADKVVALELGATDFIAKPFGTREFLARIRVALRVRPNVMRTKDRRSFCFAGWTLSLRQRRLVSAQNGEVKLTAGE 160
228861208  81 DRLEEADKVVALELGATDFIAKPFGTREFLARIRVALRVRPNVMRTKDRRSFCFAGWTLSLRQRRLVSAQNGEVKLTAGE 160
16119794  173 FNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEGDPTTPQLIKTARGAGYFFDADVDVSYGGVMA 252
10955154  161 FNLLLAFLEKPRDVLSREQLLIASRVRDEEVYDRSIDVLILRLRRKLEADPSSPQLIKTARGAGYFFDADVQVSHGGTMA 240
10954972  173 FNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEGDPTTPQLIKTARGAGYFFDADVDVSYGGVMA 252
86359758  166 FNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEQDAANPRLIKTARGAGYFFDIDVNVSYGGVMA 245
86751487  160 FNLLMAFLGAPKQVLSREQLLAASRVHNEEIFDRSIDVLILRLRRKLEPDPSNPKLIVTERGAGYVLDADVAVEHRPVGR 239
190014778 187 FNLLLAFLEKPRDVLSREQLLIASRVRDEEVYDRSIDVLILRLRRKLEADPSSPQLIKTARGAGYFFDADVQVSHGGTMA 266
150378112 161 FNLLVAFLEKPREVLSREQLLLASRVRGEEVYDRSVDVVILRLRRKLESDPANPRLIKTFRGAGYFFEADVDIHYGGTLA 240
222080238 161 FNLLVAFLEKPRDVLSREQLLIASRVRDEEVYDRSIDVLILRLRRKLEEDSASPHLIKTARGAGYFFDADVNVSFGGMMA 240
228861207 161 FNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEQDAASPNLIKTARGAGYFFDADVDVSYGGLMA 240
228861208 161 FNLLVAFLEKPRDVLSREQLLIASRVREEEVYDRSIDVLILRLRRKLEQDAASPNLIKTARGAGYFFDADVDVSYGGLMA 240
16119794  253 A 253
10955154  241 A 241
10954972  253 A 253
86359758  246 A 246
86751487  240 K 240
190014778 267 A 267
150378112 241 A 241
222080238 241 A 241
228861207 241 A 241
228861208 241 A 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap