Conserved Protein Domain Family
PRK13855

?
PRK13855: PRK13855 
type IV secretion system protein VirB10; Provisional
Statistics
?
PSSM-Id: 172376
View PSSM: PRK13855
Aligned: 9 rows
Threshold Bit Score: 692.414
Threshold Setting Gi: 150378117
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190404474   1 MEDVNAQSREGIDAPGSLVTDPHGRRLSGSQKLLVAGLVLVLSLSLIWLGARSKKRTEPSPPNTMIDANTKPFRPAPIDI 80 
150378117   1 MNDANPQTRHDVDADGSLVSESTRRRLSGPQKLMIASTIVASSLSLIWVSGSSKKEVEPTPPQTTVLTNTEPFRPAPIEV 80 
190014776   1 MNNDSQQAAHEVDASGSLVSDKHRRRLSGSQKLIVGGVVLALSLSLIWLGGRQKKVNENASPSTLIATNTKPFHPAPIEV 80 
86359756    1 MIGDDQQPSHDIDAGGSLVSGTHHQRLSGPRKLIVAGLVLVLSLGLIWLGGRQKKADANPPPSPMISTNTQPFHPAPIEI 80 
10954808    1 MEDVNAQSREGIDAPGSLVTDPHGRRLSGSQKLLVAGLVLVLSLSLIWLGARSKKRTEPSPPNTMIDANTKPFRPAPIDI 80 
10954970    1 MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSLSLIWLGGREKKENGDAPPSTMIATNTKPFHPAPIDV 80 
10955152    1 MNNDSQQAAHEVDASGSLVSDKHRRRLSGSQKLIVGGVVLALSLSLIWLGGRQKKVNDNASPSTLIAANTKPFHPAPIEV 80 
16119792    1 MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSLSLIWLGGREKKENGDAPPSTMIATNTKPFHPAPIDV 80 
222080240   1 MEEVSAQSREGIDAPGSLVTDLHGRRLSGSQKLLVAGLVLVLSLGLIWLGARPKKKTEPSPPNTVIDANTKPFRPAPIDI 80 
190404474  81 PAKPAMTPPAAEATVLPSDQHQREHNELRPEETPIFAYSGGDQngvkSAPHADIQNGGQDNRNANSLAASEDSAENDLSV 160
150378117  81 APVRSAPPSVGQPEAPPSAQSSSEPNDPRAEQSPIFAYESGEQ----DTGHAREDKEDDTSKQLPSRLADEASVDNDLST 156
190014776  81 PPDPPAVQEAVQPAAPLPPRGEPERHEPRPEETPIFAYSSGDQgvskRAIQGDTGRRQEGKRDDNSLPNGEVSGENDLSI 160
86359756   81 SPDAPPAERAVQLPAP-----EPARSEPQPAETPIFAYTGGDD----RPGHGATGR-QDDKDEERTPPNGEVSAGSDVSI 150
10954808   81 PAKPAMTPPAAEATVLPSDQHQREHNELRPEETPIFAYSGGDQngvkSAPHADIQNGGQDNINANSLAASEDSAENDLSV 160
10954970   81 TLDPPAAQEAVQPTAPPPARSEPERHEPRPEETPIFAYTSGDQgtskRVQQGETDRRREGNGEDSPLPKVEVSAENDLSI 160
10955152   81 PPDTPAVQEAVQPTVPQPPRGEPERHEPRPEETPIFAYSSGDQgvskRASQGDMGRRQEDKRDDNSLPNGEVSGENDLSI 160
16119792   81 TLDPPAAQEAVQPTAPPPARSEPERHEPRPEETPIFAYTSGDQgtskRVQQGETDRRREGNGEDSPLPKVEVSAENDLSI 160
222080240  81 PTTPP---PTSEATVLPSDQHQREHNELRPEETPIFAYSGGTQngvkSVANAEIKNGDDDDRNPDSLAVSEHSAENDLSA 157
190404474 161 RLKPTVLQPSLAILLPHPDFTVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGATGNVVLLDRGTTVVGEIQRGLQQGD 240
150378117 157 RMKAGVQEPSRATLLPHPDFTITQGTIIPCILQTAIDTSLPGYVRCLLPQDVRGATNNVVLLDRGTTVIGEIQRGLQQGD 236
190014776 161 RMKPTELQPSSATLLPHPDFMVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGTTNNIVLLDRGTTVVGEIQRGLQQGD 240
86359756  151 RMKPTELQPSKATLLPHPDFMITQGTIIPCILQTAIDTNLAGYVKCVLPRDVRGTTNNVVLLDRGTTVVGEIQRGLQQGD 230
10954808  161 RLKPTVLQPSLAILLPHPDFTVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGATGNVVLLDRGTTVVGEIQRGLQQGD 240
10954970  161 RMKPTELQPTRATLLPHPDFMVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNNVVLLDRGTTVVGEIQRGLQQGD 240
10955152  161 RMKPTELQPSRATLLPHPDFMVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGTTNNIVLLDRGTTVVGEIQRGLQQGD 240
16119792  161 RMKPTELQPTRATLLPHPDFMVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNNVVLLDRGTTVVGEIQRGLQQGD 240
222080240 158 RLKPTVVQPSLATLLPHPDFTVTQGTIIPCILQTAIDTHLAGYVKCVLPQDIRGATGNVVLLDRGTTVVGEIQRGLQQGD 237
190404474 241 ARVFVLWNRAETPSHAVVSLSSPGADELGRSGLPGTVDNHFWKRFSGAMLLSVVQGAVQAASSYAgNSTGGTSFNSFQNN 320
150378117 237 ARVFVIWNRAETPHHAVVSLASPGADELGRSGMPGTVDNHFWQRFAGAMLLSVVQGAFQAASQHT-ESSGGPNLNSFQSN 315
190014776 241 GRVFVLWDRAETPDHAMISLTSPSADELGRSGLPGSVDSHFWQRFSGAMLLSVVQGAFQAASTYAgSSGGGMSFNSFQNN 320
86359756  231 ARVFVLWDRAETPNHAMISLSSPGTDELGRSGLPGTVDNHFWQRFGGAMLLSVVQGAFQAASTYAgSSDGGTSFNSIQNN 310
10954808  241 ARVFVLWNRAETPSHAVVSLSSPGADELGRSGLPGTVDNHFWKRFSGAMLLSVVQGAVQAASSYAgNSTGGTSFNSFQNN 320
10954970  241 ARVFVLWDRAETPDHAMISLASPSADELGRSGLPGTVDNHFWQRFSGAMLLSVVQGAFQAASTYAgSSGGGTSFNSVQNN 320
10955152  241 ERVFVLWDRAETPDHAMISLTSPSADELGRPGLPGSVDSHFWQRFSGAMLLSAVQGAFQAASTYAgSSGGGMSFNSFQNN 320
16119792  241 ARVFVLWDRAETPDHAMISLASPSADELGRSGLPGTVDNHFWQRFSGAMLLSVVQGAFQAASTYAgSSGGGTSFNSVQNN 320
222080240 238 ARVFVLWNRAETPSHAVVSLSSPGADELGRSGLRGTVDNHFWKRFSGAMLLSVVQGAVQAASSYAgNSAGGTSFNSFQNN 317
190404474 321 GEQAADTALRAAINIPPTLKKNQGDTVSIFVARDLDFSGIYQLHMTGGSVKRRHLR 376
150378117 316 GAQAADTALKTTINIPPTLQKNQGDAVSIFVARDLDFSGIYELRMTTATTSARHRR 371
190014776 321 GEQTTETALKATINIPPTLKKNQGDTVSIFVARDLDFFGVYQLRLTGGATRGRNRR 376
86359756  311 GEQTADTALKATINIPPTLRKNQGDTVSIFVARDLDFSDIYQLRVTGGATRYRQHR 366
10954808  321 GEQAADTALRAAINIPPTLKKNQGDTVSIFVARDLDFSGIYQLHMTGGSVKRRHLR 376
10954970  321 GEQTADTALKATINIPPTLKKNQGDTVSIFVARDLDFSGIYQLRMAGRAARGRDRR 376
10955152  321 GEQTTETALKATINIPPTLKKNQGDTVSIFVARDLDFFGVYQLRLTGGAARGRNRR 376
16119792  321 GEQTADTALKATINIPPTLKKNQGDTVSIFVARDLDFSGIYQLRMAGRAARGRDRR 376
222080240 318 GEQAADTALRATINIPPTLTKNQGDTVSIFVARDLDFSGIYQLYVTGGSVKRRRLP 373
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap