Conserved Protein Domain Family
PRK13854

?
PRK13854: PRK13854 
type IV secretion system protein VirB3; Provisional
Statistics
?
PSSM-Id: 139914
View PSSM: PRK13854
Aligned: 10 rows
Threshold Bit Score: 145.352
Threshold Setting Gi: 148244026
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16119784    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAG 80 
10955145    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAG 80 
10954963    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAG 80 
10954801    1 MNADLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVVVQNPLYEIVLLPLWLGARLIVERDYNAASVVLLFLQTAG 80 
86359749    1 MNERLEEATLYLAATRPALFLGVPLTLAGIFMMLGGFVIVVVQNPLYEVVIIPLWFSARLVVERDYNAASVVLLFLQTAG 80 
190014769   1 MADRLEESTLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLVPLWFAARLIVERDYNAASVVLLFLRTAG 80 
190404467   1 MNADLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVVVQNPLYEIVLLPLWLGARLIVERDYNAASVVLLFLQTAG 80 
148244026   1 MTER-QRDPLFVAATRPALFLGLPIEMAVVIIMIAAMIVIFGHNPFYLTLVLPLWFGARCLVRYDYNAPRVAWLWFRTKA 79 
150378124   1 MSDRLEESTLYVAATRPALFLGVPLNLAALLMMLAGLIIVVVQNPLYEIILVPLWFGSRVVVERDYNAASVALLYLRTAG 80 
222080246   1 MIKDLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVIVQNPLYEIVLLPLWLGARLVVERDYNAASVVLLFLQTAG 80 
16119784   81 RSV-DGLIWGGASVSPNPIKVPARGRGMA 108
10955145   81 RSI-DSAVWGGATVSPNPIRVPPRGRGMV 108
10954963   81 RSV-DGLIWGGASVSPNPIKVPARGRGMA 108
10954801   81 RSV-DGHAWGGASVSPNPIRVASRGRGMT 108
86359749   81 RNV-DGLVWGGASVSPNPIRVPARGRGMA 108
190014769  81 RSI-DSAVWGGATVSPNPIRVPPRGRGMV 108
190404467  81 RSV-DGHAWGGASVSPNPIRVASRGRGMT 108
148244026  80 TGAgENQAWGGASPAPFPMKV-QQGRGMR 107
150378124  81 RSV-DAPFWGGASVSPNPIKVPRRGRGML 108
222080246  81 RSV-DGHTWGGASVSPNPIRVASRGRGMT 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap