Conserved Protein Domain Family
PRK13853

?
PRK13853: PRK13853 
type IV secretion system protein VirB4; Provisional
Statistics
?
PSSM-Id: 139913
View PSSM: PRK13853
Aligned: 10 rows
Threshold Bit Score: 1388.81
Threshold Setting Gi: 148244027
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148244027   1 MPVNRIRAERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPYELAADADRAASLVTVNALCKNVADDNVTLHSAFVR 80 
150378123   1 MFGTNGRNERSGEIYLPYVGHLSDQVVLLEDGSVMAMAHVKGLPFEMEDVAIRNARCRAFNTLLRNIADDSVSICAHLVR 80 
190404468   1 MFGASGRTERSGEIYLPYVGHLSDHVVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80 
190014770   1 MLGASGTTERSGEIYLPYIGHLSDHIVLLEDGSIMTIARIDGVAFELEETEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80 
86359750    1 MLGTSGTTERSGEVYLPYVGHLSDHIVLLEDGSIMTMAHISGVAFELEDAEMRNARCRAFNTLLRNIADDHVSLYAHLVR 80 
10954802    1 MFGASGRTERSGEIYLPYVGHLSDHVVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80 
10954964    1 MLGASGTTERSGEVYLPYVGHLSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80 
10955146    1 MLGASGTTERSGEIYLPYIGHLSDHIVLLEDGSIMSIARIDGVAFELEEIEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80 
16119786    1 MLGASGTTERSGEVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80 
222080245   1 MFGANGRTERSGEIYLPYVGHLSDHIVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80 
148244027  81 GPGAGQLAHAVMPNEFAASLDRAYRERVLAGRLYQNTWYLTVIVSPRNPLGGKAGGATaslfggKRERQKPHATAEGIRQ 160
150378123  81 HNDVALPPARHFHSGFAGSLSEAYERRVLSGKLFRNDHFLTLVVFPRTAVGKITGRFI------KRNNRNENDLANQTRN 154
190404468  81 HNDVPVPPVRHFRSTFASSLSETFERRVLSGKLFRNDHFLTLIVSPRTTLGKVGSRFT------RRYGKNPGDLAHQIRH 154
190014770  81 HADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNEHFLTLIVYPQAALGKVKRRFT------KLSGKRENDLTGQIRN 154
86359750   81 HDDVSPAPARHFRSAFSASLSGAFEQRVLCGQLLRNDHFLTLMVFPRTALGKVKRKFA------KLYMKKENELAGQIRH 154
10954802   81 HNDVPVPPVRHFRSTFASSLSETFERRVLSGKLFRNDHFLTLIVSPRTALGKVGSRFT------RRYGKNPGDLAHQIRH 154
10954964   81 HDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRFT------KRYRQKENDLTAQTRN 154
10955146   81 HADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNDHFLTLIVYPQAALGKVKRRFT------KLSGKRENDLAGQIRN 154
16119786   81 HDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRFT------KRYRQKENDLTAQTRN 154
222080245  81 HSDVPAPPVRHFRSAFASSLSETFEQRVLSGKLFRNDHFLTLIVSPRTALGKVRSRFT------TRYGKNLGDLAHQIRH 154
148244027 161 LEEVWQTISQTLAPYDVRRLGLRpaANGQFYFSEIAEALRLILTGTAAPVPLVSGPLGAALYTDRAIFGRRVFELRGPGV 240
150378123 155 LEDLWHITSGALDAYGLRRLGLR--EKDGVIFSEIAEALRLIMTCRATPVPVVSGSLGASIYTDRVICGKRALEIRTPGD 232
190404468 155 LEDLWNVVAGALDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGASVYTDRVICGKRALEIRAPKD 232
190014770 155 MEDLWHVVAGSLKAYGLHRLGIR--EKQGVLFTEIGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
86359750  155 LEDLWHVVAGALEEYGLRRLGVR--EKQDVLFSEVGEALRLVMTGRFAPVPVVSGSLGASIYTDRVICGKRGIEIRTPKE 232
10954802  155 LEDLWNVVAGTLDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGASVYTDRVICGKRALEIRAPKD 232
10954964  155 LEDLWHLVAGALEAYGLRRLGIR--EKQDVLFTEVGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
10955146  155 MEDLWHVVAGSLKAYGLHRLGIR--EKQGVLFTEIGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
16119786  155 LEDLWHLVAGALEAYGLRRLGIR--EKQDVLFTEVGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
222080245 155 LEDLWNIVAGALDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGAAVYTDRVICGKRALEIRAPKD 232
148244027 241 SRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFHARHTSEKRLGLKAAQMTAANDKARSQISDLADAQDHLASG 320
150378123 233 SYVGSLFSFREYPAKTRPGMLNPLLSANFPLVLSQSFSFLTRAQAHAKLSLKSSQMTSSGDKAVSQINELAEAEDALASS 312
190404468 233 RYVGSIFSFREYPAKTRPGMLNTLLSSSFPLVLSQSFSFLTRAQAHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
190014770 233 SYVGSIYSFREYPAKTRPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDALASN 312
86359750  233 SYVGSIYSFREYPARTRPGMLNTLLSLDFPIVLTQSFSFLTRAQAHAKLSLKSRQMLSSGDKAVTQISELAEAEDALASN 312
10954802  233 RYVGSIFSFREYPAKTRPGMLNTLLSSSFPLVLSQSFSFLTRAQAHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
10954964  233 SYVGSIYSFREYPATTRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASN 312
10955146  233 SYVGSIYSFREYPAKTRPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDALASN 312
16119786  233 SYVGSIYSFREYPATTRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASN 312
222080245 233 RYVGSIFSFREYPAKTRPGMLNILLLSSFPLVLSQSFSFLTRAQSHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
148244027 321 KIAMGEHHFSLTVYADTIEELDRLSGLTRTVIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFEA 400
150378123 313 EFVMGAHHLSLCVYADDLNSLANRAASARTRLTDAGAVIVQEGIGMEAAYWAQLPGNTKWRTRPGAITSRNFAGLVSFEN 392
190404468 313 EFVMGSHHLSLCVYGDDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQLPGNHRWRTRPGAITSRNFAGLVSFEN 392
190014770 313 EFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGNFKWRTRPGAITSRNFAGFVSFEN 392
86359750  313 QFVMGSHHLSLCIYAKDLESLADKGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNCRWRTRPGAINSRNFAGLVSFEN 392
10954802  313 EFVMGSHHLSLCVYGDDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQLPGNHRWRTRPGAITSRNFAGLVSFEN 392
10954964  313 EFVMGAHHVSLCIYANDLNSLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWRTRPGAITSRNFAGLVSFEN 392
10955146  313 EFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGNFKWRTRPGAITSRNFAGFVSFEN 392
16119786  313 EFVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWRTRPGAITSRNFAGLVSFEN 392
222080245 313 EFVMGSHHLSLCVYADDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQFPGNHRWRTRPGAITSRNFAGLVSFEN 392
148244027 401 FPRGQRAGKWGPAMARFRTTAGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALFPQYFAARNGAVVFFDKDRGGEL 480
150378123 393 FPSGKDSGHWGNSVARFRTNGGTPFDYLPHENDVGMTAIFGPVGKGKTTLMTFVLAMLEQSMVGHDGAIVFFDKDRGGEL 472
190404468 393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSVVDRSGTIVFFDKDRGGEL 472
190014770 393 FPEGASSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGEL 472
86359750  393 YPEGARSGHWGDAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMLEREGAVVFFDKDRGGEL 472
10954802  393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSVVDRSGTIVFFDKDRGGEL 472
10954964  393 FPEGSGSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSEL 472
10955146  393 FPEGASSGHWGTAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGEL 472
16119786  393 FPEGSGSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSEL 472
222080245 393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSMAGRSGTIVFFDKDRGGEL 472
148244027 481 LCRAVGGRYLVVRAGRDSGLAPLKALDNTPESVAFLVQWLTALIQQDGHGPLPPEDDARLTRGVQALLRLAPDMRSLAGL 560
150378123 473 LVRATGGTYLALRRGVPSGLAPLRALDDTSASRDFLREWVTALIESDGRGAISPEENRRLERAIVRQLSFEPAMRSLAGL 552
190404468 473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
190014770 473 LVRATGGTYLALHRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMRSIAGL 552
86359750  473 LVRATGGTYLALRRGVPSGLAPLRGLENTAASRDFLREWLVALIESDGRGGISPEENRRLVRGIHRQLSFDPPMRSIAGL 552
10954802  473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
10954964  473 LVRATGGTYLALRRGAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHMRSIAGL 552
10955146  473 LVRATGGTYLALRRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMRSIAGL 552
16119786  473 LVRATGGTYLALRRGAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHMRSIAGL 552
222080245 473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
148244027 561 RQFLDWRNPMGAGARLERWCKGGSLGWAFDGERDDVSLEATTVGFDLTAILDNGTVCAPAANYLLYRISQALDGRRFVLS 640
150378123 553 REFLLHSPSEGAGARLERWCRGNALGWAFDGEVDEVRLHASITGFDMTQILEYEEVCAPAAAYLLHRVGAVVDGRRFVMC 632
190404468 553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMVDGRRFVMS 632
190014770 553 REFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMS 632
86359750  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDDVRLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGALLDGRRFVMS 632
10954802  553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVNLDPSITGFDMTHLLEYGEVCAPAAAYLLHRIGAMVDGRRFVMS 632
10954964  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYEEVCAAAAAYLLHRIGAMVDGRRFVMS 632
10955146  553 REFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMS 632
16119786  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYEEVCAAAAAYLLHRIGAMVDGRRFVMS 632
222080245 553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVKLDPSITGFDMTHLLDYEEVCAPAAAYLLHRIGAMVDGRRFVMS 632
148244027 641 CDEFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQCQTLVFCPTPGAEEHLYRKRLNFTAGE 720
150378123 633 CDEFRFYLLNPQFAAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYVGGLKCTEGE 712
190404468 633 CDEFRSYLLNQKFAAVVDKFLLTVRKNNGMLVLATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
190014770 633 CDEFRAYLLNPKFSTVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYVDGLKCTEKE 712
86359750  633 CDEFRAYLLNPKFSAVIDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTANRSAYIDGLKCTEKE 712
10954802  633 CDEFRSYLLNQKFAAVVDKFLLTVRKNNGMLVLATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
10954964  633 CDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
10955146  633 CDEFRAYLLNPKFSAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
16119786  633 CDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
222080245 633 CDEFRAYLLNQKFAAVVDKFLLTVRKNNGMLILATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
148244027 721 FRAIAEDMLPNSRQLLIKRHGGSAIIDFDLSALPEFVAILSSRKSSVGFVEQLRATHGDDPAAWLPAFMARFHEEVE 797
150378123 713 YQAVREQMAIGSRKFLLKRESGSVICEFDLGEMREYVAVLSGRANTVRFADQLRARHGDAPGAWVDEFMARYQEVQD 789
190404468 713 FQAIREEMAIGSRKFLLKRESGSVVCEFDLRDMPEYVAVLSGRANTVRFAQQLRETHGEEPSAWLEKFMTRYHEAQD 789
190014770 713 FQAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFATRLREAQEGNSSGWLSEFMARHHEAED 789
86359750  713 FQAIREEMAVGNRKFLLKRESGSVICEFDLREMREYIAVLSGRANTVRFADQLREARGEDPSAWLSEFMNRYHEAKD 789
10954802  713 FQAIREEMAIGSRKFLLKRESGSVVCEFDLRDMPEYVAVLSGRANTVRFAQQLRETHGEEPSAWLEKFMTRYHEAQD 789
10954964  713 FQAIREDMAVGSRKFLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMARYHEAKD 789
10955146  713 FQAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFAARLREAQEGNSSGWLSEFMARHHEAED 789
16119786  713 FQAIREDMAVGSRKFLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMARYHEAKD 789
222080245 713 FQAIREDMAIGSRKFLLKRESGSVVCEFDLRDMSEYVAVLSGRANTVRFAQQLRETCGEDPSAWLDEFMTRYREAQD 789
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap