Conserved Protein Domain Family
PRK13852

?
PRK13852: PRK13852 
type IV secretion system protein
Statistics
?
PSSM-Id: 139912
View PSSM: PRK13852
Aligned: 10 rows
Threshold Bit Score: 342.607
Threshold Setting Gi: 148244029
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10955148    1 MNFTIPAP----FTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVDTRSGITRVITVTIVVA 76 
10954966    1 MNFTIPAP----FTAIHTIFDLAFTTSLDTMLGTIQEAVSAPLVACVTLWIIVQGILVMRGEIDTRGGITRVITVTVVVA 76 
10954804    1 MNFSIPAP----FTAIHTIFDLAFTVGLDTLLGDIQRAVSAPLVACVTLWIIVQGILVMRGEMDARGGITRVIMVSVVVA 76 
41223308    1 MNFTIPAP----FTAIHTIFDLAFTTSLDTMLGTIQEAVSAPLVACVTLWIIVQGILVMRGEIDTRGGITRVITVTVVVA 76 
86359752    1 MNFTIPAP----FTAIHTIFDLAFKTRLDTVLEAIQEKVSAPLIACVTLWIIVQGVLVMRGEVDVRGGITRVIMVSVVVA 76 
190014772   1 MNFTIPAP----FTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVDTRSGITRVITVTIVVA 76 
190404470   1 MNFSIPAP----FTAIHTIFDLAFTVGLDTLLGDIQRAVSAPLVACVTLWIIVQGILVMRGEMDARGGITRVIMVSVVVA 76 
148244029   1 --MSVPNTtiniFEFMYNQYSTGFLQSLNSDVGSALSAALPPLSAALVIWVIILGYLMMTGSLDIRYGISKVSTMAIVVG 78 
150378121   1 MKFSVSAP----FTTIHTVFDTAFTIALDSVLEKIQSAINAPLVACVTLWIIVQGILVIRGEIDARVGIMKIIRVSIVVA 76 
222080243   1 MNFSIPAP----FTAIHTIFDLAFTVGLDTLLGDIQRAVSAPLVACVTLWIIVQGILVMRGEMDARGGITRVIMISVVVA 76 
10955148   77 LIVGQANYQDYVVSIFEKTVPIFVQQFSVTGLPLQTVPAQLDTIFA----VTQAVFQKIASEIGPMNDQDI-LAFQGAQW 151
10954966   77 LVVGQANYHDYVVSVFEETIPNFIQQFSGSGLPLQTIPAQLDTMFA----LTQAAFQRIASEIGPMNDQDI-LAFQGAQW 151
10954804   77 LIVEQAEYHDYVVSVFEDTIPNFIQQFGISGLPLQTIPAQLDTMFS----LTQVAFQKIASEIGPMNDQDI-LAFQGAQW 151
41223308   77 LVVGQANYHDYVVSVFEETIPNFIQQFSGSGLPLQTIPAQLDTMFA----LTQAAFQRIASEIGPMNDQDI-LAFQGAQW 151
86359752   77 LVVGQANYHDYVVSVFEETIPDFIQQFSGSGLPLQTIPTQLDSMFA----LSQAAFQKIASEIGPMNDQDI-LAFQGAQW 151
190014772  77 LIVGQANYQDYVVSIFEKTVPNFVQQFSVTGLPLQTVPAQLDTMFA----VTQAVFQKIASEIGPMNDQDI-LAFQGAQW 151
190404470  77 LIVEQAEYHDYVVSVFEDTIPNFIQQFGISGLPLQTIPAQLDTMFS----LTQVAFQKIASEIGPMNDQDI-LAFQGAQW 151
148244029  79 IIASTSLYDSYVQTLFMKSLPSFVASTFSSG-NTSNIPQSLDQTFNnfwvAGQIIYKKANCATCVLEPYVLgIEIELVLV 157
150378121  77 LILGQANYHSYVVLFFEDTIPNFVHKISGSSIALINIPQQLDLMFA----LSLSSFQKIAAEIGPMNSQDI-LAFEGAQW 151
222080243  77 LVVEQAEYHDYVVSVFEDTIPNFIQQFGISGLPLQTIPAQLDTMFS----LTQVAFQKIASEIGPMNDQDI-LAFQGAQW 151
10955148  152 VLYGTLWSAFGVYDAVGILTKVLLAIGPLILVGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLG 231
10954966  152 VFYGTLWSAFGIYDAVGILTKVLLAIGPLILTGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLG 231
10954804  152 IFYGTLWTAFGIYDAVGILTKVLLAIGPLMLVGYLFDRTRDMAAKWIGQLVTYGILLLLLNIVATIVVLTEATALVLMLG 231
41223308  152 VFYGTLWSAFGIYDAVGILTKVLLAIGPLILTGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLG 231
86359752  152 VFYGTLWSAFGIYDAVGILTEVLLTIGPLVLVGYIFDRTRDIAAKWIGQLITYGFLLLLLNIVATIVILTEATALALILG 231
190014772 152 VLYGTLWSAFGVYDAVGILTKVLLAIGPLILVGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLG 231
190404470 152 IFYGTLWTAFGIYDAVGILTKVLLAIGPLMLVGYLFDRTRDMAAKWIGQLVTYGILLLLLNIVATIVVLTEATALVLMLG 231
148244029 158 VFFIALALVFAVYLISTTLTGLLVAIGPFLLIGYLFEATKGIPERWLGKLIGLAILLLLITALLSLFTGGMTDFLNTKVS 237
150378121 152 VFYGALWVTFEVYDACGILTKVLLAIGPLILVGYLFDHTRDMASKWVGQLLSYGLLLLLLNIVATIVITTEVVALKLMLI 231
222080243 152 IFYGTLWTAFGIYDAVGILTKVLLAIGPLILIGYLFDRTRDMAAKWIGQLLTYGILLLLLNVVATIVVLTEATALVLILA 231
10955148  232 VITFAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQSASSLYRRFAQVERG 295
10954966  232 VITLAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQSANSLYRRFAQVERR 295
10954804  232 VITSAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQTAGSLNRHFARTIRR 295
41223308  232 VITLAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQSANSLYRRFAQVDRR 295
86359752  232 VITLAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGVTQSANSLYRRFAQVERR 295
190014772 232 VITFAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQSASSLYRRFAQVERG 295
190404470 232 VITSAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGATQTAGSLNRHFARTIRR 295
148244029 238 TTFTADPVQTEIIILGEIAAYTAITAFITIMLPGIAAYIGGGvdfNISGIVNPANWFK--------- 295
150378121 232 VINNAGTTAAKIIGLYELDMLFLAGDALIVALPVIAGNIAGA---HWSGSNKSLSSLSRQLAQVARR 295
222080243 232 AVTSAGTTAAKIIGLYELDMFFLTGDALIVALPAIAGNIGGS---YWSGGTQTVGSLNRHLARTIRR 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap