Conserved Protein Domain Family
PRK13851

?
PRK13851: PRK13851 
type IV secretion system protein VirB11; Provisional
Statistics
?
PSSM-Id: 172375
View PSSM: PRK13851
Aligned: 10 rows
Threshold Bit Score: 643.874
Threshold Setting Gi: 148244034
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150378116   3 TEADPQLRLLLKPVLEWLEDPRTEEVAINRPGEAFVRQAGAFTKHPLSLTYDDLEDIAILAGALRKQDVGPRSPLCATEL 82 
148244034  14 SPAAPLLRFLLAPLQPWLNDGATEELCINRPGECWVRQRGVFERFKVPLDRSALEDIAVLAGALRRQDVGPTSPLCSTEL 93 
190404475   1 MEVNPQLRALLNPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
190014777   1 MEVDPQLRFLLKPILEWLDDPKTEEIAINRPGEAFVRQAGIFTKMPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
86359757    1 MEVNTQLRFLLNPVLEWLDDPRTEEVAINRPGEAFLRQGGIFTKMSLPLSYNDLEDIAILAGALRKQDVGPRNPLCATEL 80 
41223310    1 MEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAFLKFPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
10954809    1 MEVNPQLRALLNPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
10954971    1 MEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAFLKFPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
10955153    1 MEVDPQLRFLLKPILEWLDDPKTEEIAINRPGEAFVRQAGIFTKMPLPVSYDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
222080239   1 MEVNPQLRVLLKPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSCDDLEDIAILAGALRKQDVGPRNPLCATEL 80 
150378116  83 PGGERLQICLPPAVQSGTVSLTIRRPSSRVSELKEVSSRYDASRWNQWRFRQERQTQQDMqiLEHYARGNLEEFLQACVT 162
148244034  94 PGGERLQICLPPAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSDGWNSWAENRDTRNFAEA--LDYYDSGDLEGFLAAAVR 171
190404475  81 PGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDVRRWNQWQIRTQRRDQLDEaiLRDYDNGDLESFLRACVI 160
190014777  81 PGGERLQICLPPTVPSGTVSLTIRRPSSRVSGLKEVSSRYDASRWNQWQTRRKRQNQDDEaiLQHFDNGDLEAFLHACVV 160
86359757   81 PGGERLQICLPPAVLAGTVSLTIRRPASHVSGLNGVTDRYDVSRWNQWERRKRRRDQQDEtiLRHYDSGDLEAFLHACVV 160
41223310   81 PDGERLQICLPPTVPSGTVSLTIRRPSSRVSSLKEVSSRYDAPRWNQWKERKKRHDQHDEaiLRYYDNGDLEAFLHACVV 160
10954809   81 PGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDVRRWNQWQIRTQRRDQLDEaiLRDYDNGDLESFLRACVI 160
10954971   81 PDGERLQICLPPTVPSGTVSLTIRRPSSRVSSLKEVSSRYDAPRWNQWKGRKKRHDQHDEaiLRYYDNGDLEAFLHACVV 160
10955153   81 PGGERLQICLPPTVPSGTVSLTIRRPSSRVSGLKEVSSRYDASRWNQWQTRRKRQNQDDEaiLQHFDNGDLEAFLHACVV 160
222080239  81 PGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDARRWNQWQIRTQRRDQLDEaiLRDYDNGDLESFLRACVI 160
150378116 163 GRLTMLLCGHTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVRLLYSKDGAGVGGVTAEQLLQASLRMRPDRI 242
148244034 172 CRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTAELVIPQPNHVRLLYSKDGLSTAKIDAEALLQASLRMRPDRV 251
190404475 161 GKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVRLLYSKSGAGLGAVTAEQLLQASLRMRPDRI 240
190014777 161 SRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHDNHVRLLYSKNGAGLGAVSAEHLLQASLRMRPDRI 240
86359757  161 GRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHENHVRLLYAKNAGGPDAVTAEHLLQASLRMRPDRI 240
41223310  161 GRLTMLLCGPTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVRLLYSKNGAGLGAVTAEHLLQASLRMRPDRI 240
10954809  161 GKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVRLLYSKSGAGLGAVTAEQLLQASLRMRPDRI 240
10954971  161 GRLTMLLCGPTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVRLLYSKNGAGLGAVTAEHLLQASLRMRPDRI 240
10955153  161 SRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHDNHVRLLYSKNGAGLGAVSAEHLLQASLRMRPDRI 240
222080239 161 GKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVRLLYSKSGGGLGAVTAEQLLQASLRMRPDRI 240
150378116 243 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGADAVQGFKKLFSLVKSSPQGAAIEDRTLIDMLSAAIDVIVPFRTYGDVYE 322
148244034 252 LLQELRDDAAWTYVNEVVSGHPGSITTIHGANPAQAFKKLFSLIKGSPKGASFDDATLCDLLAAAVDLIIPFETSGTTYR 331
190404475 241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSVQGACLEDRTLIDMLATAIDVIVPFRAYGDVYE 320
190014777 241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPIQGFKKLFSLVKSSAQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYE 320
86359757  241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSSQGAGLEDRTLIDMLSSAIDVIIPFRAYGDIYE 320
41223310  241 LLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYE 320
10954809  241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSVQGASLEDRTLIDMLATAIDVIVPFRAYGDVYE 320
10954971  241 LLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYE 320
10955153  241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPIQGFKKLFSLVKSSVQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYE 320
222080239 241 LLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSAQGASLEDRTLIDMLATAIDVIVPFRAYGDVYE 320
150378116 323 VGEIWLAADARRRGETVAGLLDQH 346
148244034 332 IGKVWFGPDATRRGETAAALLRAA 355
190404475 321 VGEVWLAADARRRGETIGDLLNQQ 344
190014777 321 VGEIWLAADARRRGETIGDLLNQ- 343
86359757  321 VEEIWLAADARRRGEAIGDLLDQH 344
41223310  321 VGEIWLAADARRRGETIGDLLNQQ 344
10954809  321 VGEVWLAADARRRGETIGDLLNQQ 344
10954971  321 VGEIWLAADARRRGETIGDLLNQQ 344
10955153  321 VGEIWLAADARRRGETIGDLLNQ- 343
222080239 321 VGEVWLAADARRRGETIGDLLNQH 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap