Conserved Protein Domain Family
PRK13849

?
PRK13849: PRK13849 
conjugal transfer ATPase VirC1
Statistics
?
PSSM-Id: 139909
View PSSM: PRK13849
Aligned: 12 rows
Threshold Bit Score: 377.261
Threshold Setting Gi: 115345631
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115345631   1 MNLITFASLKGGAGKTTSLMAACGSLVSRGTRVGLFEADDNQPLHAWREYAQGKGTWNDACEIANAMDLAAFEQAYEHFE 80 
190404480   1 MKLLTFCSFKGGAGKTTALMGLCAAFARDGKRVALFDADENRPLTRWKENAMRSNTWDTSCEVYAAEEMSLLEAAYEDAE 80 
190014780   1 MQLLTFCSFKGGAGKTTALMGLCAALANDGKRVALFDADENRPLTRWRENALQSSTWDPRCEVYSADEMPLLEAAYENAE 80 
86359760    1 MKLLTFCSFKGGAGKTTALMGVCAALANDGKRVALFDADENRPLPRWKENAIRSGTWDPCCEVYAAEEMALLEAAYEDAE 80 
116255014   1 MKLITCCSFKGGAGKTTALMGLCSWLASKKRRVALFEGDENRPLTKWKENALRNGAWDHQCEVFVADELPLLEDAYQQAE 80 
116255027   1 MQLVTCCSFKGGAGKTTALMGLCSALAADGKTIALFEADENRPLSKWKENATRRNAWDPLCEIFITDELPLLEVAYEEAA 80 
116255057   1 MQLVTCCSFKGGAGKTTALMGLCSALAADGKTIALFEADENRPLSKWKENATRRNAWDPLCEIFITDELPLLEVAYEEAA 80 
16119796    1 MKLLTFCSFKGGAGKTTALMGLCAAFASDGKRLALFDADENRPLTRWKENALRSNTWGSFCEVYAAEEMALLEAAYEDAE 80 
10954812    1 MRLLTFCSFKGGAGKTTALMGLCAAFARDGKRVALFDADENRPLTRWKENAMRSNTWDTSCEVYAAEEMSLLEAAYEDAE 80 
10954974    1 MKLLTFCSFKGGAGKTTALMGLCAAFASDGKRLALFDADENRPLTRWKENALRSNTWGSFCEVYAAEEMALLEAAYEDAE 80 
10955156    1 MQLLTFCSFKGGAGKTTALMGLCAALANDGKRVALFDADENRPLTRWRENALQSSTWDPRCEVYSADEMPLLEAAYENAE 80 
222080236   1 MKLLAFCSFKGGAGKTTALMGLCTAFARDGKRVALLDADENRPLTRWKENAIRSNTWDRSCEVYAAEEMSLLEAAYEDAE 80 
115345631  81 TSGYDIALADTQGGGSEFNATIIASSDLIVIPSALTRLDLDSTLDTYAVVDEILeQTETPDIPVAILITQMPSRRLTSAQ 160
190404480  81 LQEFDYALADTHGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVVELL-LSENLVIPTAVLRQRVPVGRLTTSQ 159
190014780  81 LEGFDYALADTRGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELL-LSENLAIPTAVLRQRVPVGRLTTSQ 159
86359760   81 LQGFDYALADTHGGSSELNNTIIASSNMLLIPTMLTPLDIDEALSTYRYVIELL-LSENLAVPTTVLRQRVPVGRLTTSQ 159
116255014  81 GAGFHYALADTHGGLSELNNVIVASSDFLLVPTMLTPLDIDEALATYRYIVELL-LAEELQTHTAILRQRVPVGRLTVSQ 159
116255027  81 GRGFDYCLVETHHGSSELNNTVIASSNLLLIPTMLTPLDADEALATFRYIIELL-IGENLAIPAAILRQRVPANRLNSSE 159
116255057  81 GRGFDYCLVETHHGSSELNNTVIASSNLLLIPTMLTPLDADEALATFRYIIELL-IGENLAIPAAILRQRVPANRLNSSE 159
16119796   81 LQGFDYALADTHGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELL-LSENLAIPTAVLRQRVPVGRLTTSQ 159
10954812   81 LQEFDYALADTLGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVVELL-LSENLVIPTAVLRQRVPVGRLTTSQ 159
10954974   81 LQGFDYALADTHGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELL-LSENLAIPTAVLRQRVPVGRLTTSQ 159
10955156   81 LEGFDYALADTRGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELM-LSENLAIPTAVLRQRVPVGRLTTSQ 159
222080236  81 LREFDYALADTHGGSSELNNTIIASSNLLLIPTMLTPLDIDEALSTYRYVIELL-LSENLVIPTAVLRQRVPVGRLTTSQ 159
115345631 161 SFCLDIIEQLPSFDCTLPYRSAFADIKSLGMLHIYREALSQIPSKRIAATHITTAIADADRLADTLLEALEA 232
190404480 160 RAMSDMLVNLPVVQSPMHERDAFAAMKERGMLHLTLLNTTNDPTMRLLERNLRIAMEELVTISELIGDTLGN 231
190014780 160 RRMSETLESLPVVPSPMHERDAFAAMKERGMLHLTLLNTGTDPTMRLIERNLRIAMEEVVVISKLISKILEA 231
86359760  160 RAMSDMLASLPVVQAPMHERDAFAAMKERGMLHLTLLNMRADSTMRLLERNIRIAMEELVVISKLIGDALEG 231
116255014 160 QTAYDMLERLPVFDVPMYERDAFAAMKERGMLHITVANLSHAPAMRLMLRNNRRALDELAMIGAFVEKALEG 231
116255027 160 RLISEMLSTLPLADTPMHERDAFAAMKDRGMLHLNLRNAAANSSMRLTLRNLEAAMEDLRSLGKFVSSTVEH 231
116255057 160 RLISEMLSTLPLADTPMHERDAFAAMKDRGMLHLNLRNAAANSSMRLTLRNLEAAMEDLRSLGKFVSSTVEH 231
16119796  160 RAMSDMLASLPVVQSPMHERDAFAAMKERGMLHLTLLNMRTDPTMRLLERNLRIAMEELVTISKLVSEALEG 231
10954812  160 RAMSDMLVNLPVVQSPMHERDAFAAMKGRGMLHLTLLNTTNDPTMRLLERNLRIAMEELVTISELIGDTLGN 231
10954974  160 RAMSDMLASLPVVQSPMHERDAFAAMKERGMLHLTLLNMRTDPTMRLLERNLRIAMEELVTISKLVSEALEG 231
10955156  160 RRMSEMLESLPVVPSPMHERDAFSAMKERGMLHLTLLNMGTDPTMRLIERNLRIAMEEVVVISKLISKILEA 231
222080236 160 RAMSNMLANLPVVQSPMHERDAFAAMKERGMLHLTLLNTTNDPTMRLLERNLRIAMEELVTISELIGKTLGN 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap