Conserved Protein Domain Family
PRK13848

?
PRK13848: PRK13848 
conjugal transfer protein TraC; Provisional
Statistics
?
PSSM-Id: 172373
View PSSM: PRK13848
Aligned: 13 rows
Threshold Bit Score: 85.9861
Threshold Setting Gi: 190404420
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16519709    1 MKKPASKIRDEIAKLQEQLRQAETREAERIGRIALKAGLGGIEVEEAELQAAFESLAKRFRGGQGGANGASSGGKKPDgn 80 
10955038    1 MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGDIEIDEAELQAAFEDVAKRFRGGKGSATGKRQAGDSRT-- 78 
10954928    1 MKKPSSKIREEIARLQDQLRQAETREAERIGRVALKAGLGEIEIEEAELQAAFEDIAGRFRGGKAGTSGRKNAGDGRT-- 78 
10954757    1 MKKPSSKIRDEIAKLQEQLKIAETKEAERIGRVALKAGLGEIEVEEGELQAAFEEVAKRFRGGKGASNGKERGGPGAV-- 78 
16119944    1 MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGEIDIEESQLQAAFEEVAKRFRGGKGSATGKRQAGESRT-- 78 
116254983   1 MKKPSAKLRDEIAKLQEQLKIAETREAERIGRIALKAGLGEIEIDEAELQAAFEQLTKRFRGGQGATAGKERGGAAVV-- 78 
86359856    1 MKKPSSKIRDEIAKLQEQLKAAETREAERIGRIALKAGLGEIEIDESELQAAFEDLAKRFRGGKVTANGGKRGSSAGE-- 78 
150377500   1 MKKPSSKIREEIGKLQEQLKQAETREAERIGRIALKAGLGEIEIDETELQDAFEHLARRFRGELAASIGGRKRVEDGI-- 78 
150377167   1 MKKPSSKIREEIGKLQEQLKQAETREAERIGRIALKAGLGEIEIDETELQDAFEHLARRFRGELAASIGGRKRVEDGI-- 78 
190014834   1 MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGEIEIDEADLQAALEEIAKRFRGGKGIATGKKDSGDGRN-- 78 
190404420   1 MKKPASKIRDEIAKLQEQLKVAETREAERIGRIALKAGLGEIEIEEGELQAAFEEVATRFRGGQGGGKGATNGGKKGAgd 80 
222080186   1 MKKPSLKIREEIARLQDQLRQAETREAERVGRIALKAGLGEIEIEETELQAAFEEITGRFRGGKAASTGKRNAGDGRT-- 78 
222080147   1 MKKPSLKIREEIARLQDQLRQAETREAERVGRIALKAGLGEIEIEETELQAAFEEITGRFRGGKAASTGKRNAGDGRT-- 78 
16519709   81 atAGASAAAVGSGAAQGGNGEA 102
10955038   79 --GSEPYATQPTGADAGGLSEA 98 
10954928   79 --AGEPGATLASGSDAGSRGEA 98 
10954757   79 ---TQQTTPNSTGAGAGSTGEA 97 
16119944   79 --GTEPSAALASGADEGGSGEA 98 
116254983  79 ---SQQTAPVTSGAGAGSAGEA 97 
86359856   79 --SSASSTQDASGAAAGGTAEA 98 
150377500  79 --PSTATATVASGAAQGGHGEV 98 
150377167  79 --PSTATATVASGAAQGGHGEV 98 
190014834  79 --ASGASTAQSSGADAGGIGEA 98 
190404420  81 ssGATSTPADSSGAGAGSTGEA 102
222080186  79 --AGETVTTIETGAAASSGREA 98 
222080147  79 --AGETVTTIETGAAASSGREA 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap