Conserved Protein Domain Family
PRK13847

?
PRK13847: PRK13847 
type IV conjugative transfer system coupling protein TraD
Statistics
?
PSSM-Id: 172372
View PSSM: PRK13847
Aligned: 12 rows
Threshold Bit Score: 96.8015
Threshold Setting Gi: 222083265
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190404419  1 MARTMTSDARKKETREKIELGGLIVKAGLRYEKRALLLGALIDVARRIKGDEGERSRLTAIGAEAFGNDDQ 71 
190014833  1 MAKTITSDARKKDTREKIELGGLIVKAGLRYEKRSLLLGLLIDANRRIRGDETEKARLAAIGAEAFGNEGE 71 
150377501  1 MARAMTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGALVELSRRLKSDEGERARLIAIGAEAFGNDSE 71 
86359855   1 MARTTTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGALIDLRQRLKADEMERSRLMAIGAEAFGKADE 71 
116254982  1 MARTMTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGALVDAARRIKSDDTERSRLTAIGVEAFGNDDQ 71 
16519710   1 MARSATSDARKKDTREKIELGGLIVKAGLRYEKRVLLLGALVDLSRRLNSDESERARLIAIGAEAFGDDGE 71 
16119943  11 MAKSMTSNARKKDTREKIELGGLIVKAGLRYEKRALLLGLLVDGGRRLKGDEEERSRLTAIGAEAFGHDDE 81 
10954756   1 MARTITSDARKKDTREKIELGGLIVKAGMRYEKRALLLGALIDAAHRIKGDEGERSRLTAIGAEAFGNDDQ 71 
10954927   1 MHRTASTDARKKDTREKIELGGLIVKAGLRYEKRALLLGMLIDAGRRIKGDDAERSRLTTIGAEAFGRDGE 71 
10955037  11 MSKAMTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGLLIDGERRLKGDEDERSRLTAIGVEAFGHDGE 81 
222083265 11 MAKSKTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGLLIDGGRRLKGDEDERSRLTAIGVEAFGHDGE 81 
222102459 11 MAKAMTTEARKKDTREKIELGALIVKAGLRYEKRALLLGLLIDANKRIKGNEAERSRLTSIGVEAFGHDGE 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap