Conserved Protein Domain Family
PRK13846

?
PRK13846: PRK13846 
phosphate acyltransferase PlsX
Links
?
Statistics
?
PSSM-Id: 139906
View PSSM: PRK13846
Aligned: 14 rows
Threshold Bit Score: 562.125
Threshold Setting Gi: 15834816
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33242330    1 MEVQIGIDLMGGDHSPLVVWQVLVDVLKSQSSTIPFAFTLFASEEIRKQIqeefISDLPQEKFPKIISAENFVAMEDSPL 80 
29840564    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSRASNSHISFIAFASREVKEQI----LSSYTHKEYPEIIASESFVAMDDSPL 76 
15605545    1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSTGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75 
15834816    1 MKVRLGVDMMGGDHDPLVVWEALEEVLLSLDGQ-PVEFSVFATPDVHQQ-----LTHSPLSRSVQMIASESFVSMEDSVL 74 
15836495    1 MEVQIGIDLMGGDHSPLVVWQVLVDVLKSQSSTIPFAFTLFASEEIRKQIqeefISDLPQEKFPKIISAENFVAMEDSPL 80 
76789554    1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSIGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75 
89898015    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSTASNSHFSFTAFASHEVQEQI----LSSCTYKECPKIIASDSFVTMDDSPL 76 
62185382    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSRASNSHISFTAFASHEVKEQI----LSHSTYKGYPEVIASESFITMEDSPL 76 
166155029   1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSTGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75 
237803242   1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSIGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75 
33242330   81 AAIRKKSSSMALGLDYLQEDKLDAFISTGNTGALVTLARAKIPLFPAVSRPALLVCVPTMRGHAVILDVGANISVKPEEM 160
29840564   77 AAIRKKSSSMALGLDYLKEDKIDAFISTGNTAALITLSRAKIPVFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
15605545   76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
15834816   75 AAVRKKRSSMALGLDSLQRGELDGFISAGNTAALVTLARAKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVAVNPEEM 154
15836495   81 AAIRKKSSSMALGLDYLQEDKLDAFISTGNTGALVTLARAKIPLFPAVSRPALLVCVPTMRGHAVILDVGANISVKPEEM 160
76789554   76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
89898015   77 SAIRKKSSSMALGLDYLKEDKIDAFISTGNTAALITLSRTKIPVFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
62185382   77 SAIRKKSSSMALGLDYLKEDKIDALISTGNTAALITLSRTKIPMFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
166155029  76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
237803242  76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
33242330  161 VGFARMGLAYRQCLGD--SKIPTIGLLNIGSEERKGTEAHRQTFRMLRETFGEAFLGNIESGAVFDGAADIVVTDGFTGN 238
29840564  157 LGFARMGLAYRQCLGK--AECPTIGLLNIGSEERKGTEAHRQTYRILKETFQDAFLGNIESGDVFGGSVDIVVADGFTGN 234
15605545  156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
15834816  155 VGFARMGLAYRQSLSSs-DQSFTLGLLNIGSEERKGTDSHKHTFRMLRDVFGSAFLGNVESGDVFSGKVDIVVTDGFTGN 233
15836495  161 VGFARMGLAYRQCLGD--SKIPTIGLLNIGSEERKGTEAHRQTFRMLRETFGEAFLGNIESGAVFDGAADIVVTDGFTGN 238
76789554  156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
89898015  157 LGFARMGLAYRQCIGE--KEHPTIGLLNIGSEERKGTEAHRQTFRILRETFQDSFLGNIESGDVFSGSVDIVVADGFTGN 234
62185382  157 LGFARMGLAYKQCLGD--TEHPTVGLLNIGSEERKGTEAHRLTFRLLRETFQHAFLGNIESGDVFSGSVDVVVSDGFTGN 234
166155029 156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
237803242 156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
33242330  239 IFLKTAEGVFEFLQRILGDKLEADIQRRLDYTFYPGSVVCGLSKLVIKCHGKACGSSLFHGILGSINLAQARLCKRILSN 318
29840564  235 IFLKTAEGVFDFLRHILGDKLESDVTRHLDYTIYPGSMVCGLSKLVIKCHGKACGKSLFNGISGSIDLARARVCERILSS 314
15605545  236 VFLKTAEGLFDFLRHILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
15834816  234 VFLKTAEGLFDFLRHILGDHLEKTIKTRFDYTIYPGSIISGLSRLVIKCHGKSRETALFGGISGAVDLARSNVCGRIAAK 313
15836495  239 IFLKTAEGVFEFLQRILGDKLEADIQRRLDYTFYPGSVVCGLSKLVIKCHGKACGSSLFHGILGSINLAQARLCKRILSN 318
76789554  236 VFLKTAEGLFDFLRRILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
89898015  235 IFLKTAEGVFDFLRHILGDKLESDVKRQLDYTIYPGSMVCGLSKLVIKCHGKACGRSLFNGISGSIDLARARVCQRILSS 314
62185382  235 IFLKTAEGVFDFLSHILGDKLESDVKRQLDYTIYPGSMVCGLSKLVIKCHGKACGRSLFNGISGSIDLVRARVCERILSS 314
166155029 236 VFLKTAEGLFDFLRHILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
237803242 236 VFLKTAEGLFDFLRRILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
33242330  319 LI 320
29840564  315 LS 316
15605545  316 FG 317
15834816  314 FG 315
15836495  319 LI 320
76789554  316 FG 317
89898015  315 LS 316
62185382  315 LS 316
166155029 316 FG 317
237803242 316 FG 317
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap