Conserved Protein Domain Family
PRK13845

?
PRK13845: PRK13845 
putative glycerol-3-phosphate acyltransferase PlsX; Provisional
Statistics
?
PSSM-Id: 172371
View PSSM: PRK13845
Aligned: 17 rows
Threshold Bit Score: 819.432
Threshold Setting Gi: 72383337
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
123965398   1 MEKDSSNKKSRAIRRLVIWYKRNSAVTSIVDTAANSAVTAGNVAGNVVSGAGSVVNTasnvagnvvsgagsvvntasnva 80 
157412491   3 KGNLQKVNKPRAIRRLVIWYKRNSAVTSIVDTAASSAVTASNVAGNVVSGAGSVVNTasnvagnvagnvvss-------- 74 
126695492   3 KESVQKINKPRAIRRLVIWYKRNSAVTSIVDTAASSAVTASNVAGNVVSSAGSVVSTasnvasnvagnvagnvv------ 76 
123967689   3 KESAQKINKPRAIRRLVIWYKRNTAVTSLVDTAASSAVTASNVAGNVVSSAGSVVSTasnvasnvagnvagnvv------ 76 
113953618  12 DEARSKPRRSKAVRRLVIWYRRNSAVTSLVDTATTSASAAGNVAESVGSMAGSVVTN----------------------- 68 
78183889   12 PEPRSKSTRPRAIRRLVIWYRRNSAVTTIVDSAASSASAAGTVAGTVVSGAGTVASS----------------------- 68 
78213893   12 PQPRHKTNRPRAIRRLVIWYRRNAAVTTIVDGAANSATAAGSMAGTV---AETVVSG----------------------- 65 
33866777   12 PESRSKSNRPRAIRRLVIWYRRNAAVTSLVDTATSSASAAGTVAGTV--------------------------------- 58 
33860695    1 MEKDSSIKKSRAIRRLVIWYKRNSAVTSIVDTAANSAVTASNVAGNVVSGAGSVVSTasnvagnvagnvvss-------- 72 
33239609    3 NESRSKAIRPKAIRRLVIWYRRNSAVTTLVDTATNSASAAGNVAGSVVSSAGSVVSS----------------------- 59 
123965398  81 gnvagnvvssaesvvntassvvsnASSIAKNTLQPLVFDPLKRLQNNDNYINKEEISNPKRIWIAVDGMGGDYAPVPILE 160
157412491  75 ----------aesvvntassvvsnASLIAKNTLQPLVFDPLKRLQNNDNILERVEESQSKRIWIAVDGMGGDYAPGPILE 144
126695492  77 --------ssaesvvntassvvsnASSIAKNTLQPLVFDPLKRLQNNDYILDKVEESQSKRIWIAVDGMGGDYAPGPILE 148
123967689  77 --------ssaesvvntassvvsnASSIAKNTLQPLVFDPLKRLQNNDNILDRVEESQSKRIWIAVDGMGGDYAPGPILE 148
113953618  69 ------------------------AGSMAGQMLQP-VMDPLRRLQT-TEVGDDGVIHDSDRLWVAVDGMGGDHAPGEILE 122
78183889   69 -------------------------------VLQPLVFDPLRRLQG---GNDEDEIKDEDRLWVAVDGMGGDDAPGPILE 114
78213893   66 ------------------------AGTVASSVLQPLGFDPLRWLQG---GTDTDEIDDAKRLWVAVDGMGGDHAPGPILE 118
33866777   59 ----------------------------ANSMLQPLVFDPLRWLQG---NTDDEEIQEADRLWVAVDGMGGDHAPGPILE 107
33860695   73 ----------aesvvntasnvvssASSIAKNTLQPLVFDPLKRLQNSDNLISKEEVPNSERIWIAVDGMGGDYAPVPILE 142
33239609   60 ------------------------AGSIARSTLQPLVFDPLRRLQAGPNELDRNDIANSKRLWVAVDGMGGDNAPGSILE 115
123965398 161 GCLDAISRFPINIKFVGKIEKVRCEAEKAGLIDLLEKEIDNNRLELIDSGDPIGMNEEATAVRKRKDASINVAMDLVKNN 240
157412491 145 GCLEAISRFPINIKFVGKIEKVKDAAEKNGLAELLENEIDNNHLELIDSGEPIGMNEEATAVRKRKNSSINVAMDLVRNN 224
126695492 149 GCLEAISRFPINIKFVGKIEEVKDAAEKTGLAELLENEIDNNRLELIDSGEPIGMNEEATAVRKRKNASINVAMDLVRNN 228
123967689 149 GCLEAISRFPINIKFVGKIETVKVAAEKTGLAELLENAVDNNRLELIDSGDPIGMNEEATAVRKRKNASINVAMDLVKNN 228
113953618 123 GSLQAIARLPLRIRFVGETNRVMEAAEASGLKEPLNNAINAGHLELIPSGPSVEMHEEATVVRRKRDASVNVAMDLVKRG 202
78183889  115 GCLQAIERLPLKIRFVGEQDRVRAAAADLELEAILEKAQASGHLELVPSGPSIGMDDEATAVRRKRDASINVAMDLVKQG 194
78213893  119 GCLDAIDRLPLKIRFVGEIERVMAAANSLGLREALETARAAGHLDLVASGPSIGMDDEATAVRRKRDASINVAMDLVKKG 198
33866777  108 GCLEAIERLPLKIRFVGETDKVLEAADALGLSERLAQAQAADHLDLVASGPSIGMDDEATAVRRKRDASINLAMDLVKKG 187
33860695  143 GCLGAISRFPINIKFVGKIEKVRYEAERVGLIDLLEKEIDNNRLELIDSGDPIGMNEEATAVRKRKDASINVAMDLVKTN 222
33239609  116 GCLQAIDRLPLCIKFVGEIEKIHSAADELGISDLLNQLISAGNIELVASGPSIGMDEEATAVRKKRDASINIAMDLVKKG 195
123965398 241 KAEAVYSAGNSGALMASAIFRIGRLKGIERPAIGALFPTRDQTRPVLVLDVGANTDCKPSYLHQFALLGNVYAKDVLQIE 320
157412491 225 KAEAVYSAGNSGAMMASAIFRIGRLKGIDRPAIGALFPTRDQTRPVLVLDVGANTDCKPSYLHQFALLGNIYAKDVLQVK 304
126695492 229 KAEAVYSAGNSGAMMASAIFRIGRLKGIDRPAIGALFPTRDQTRPVLVLDVGANTDCKPSYLHQFALLGNIYAKDVLQVK 308
123967689 229 KAEAVYSAGNSGAMMASAIFRIGRLKGIDRPAIGALFPTRDQTRPVLVLDVGANTDCKPSYLHQFALLGNIYAKDVLQVK 308
113953618 203 DALAIYSAGNSGAVMASAIFRLGRLAGIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPAYMHQFALLGNIYSRDVLQVD 282
78183889  195 RATAVYSAGNSGAVMASAIFRLGRLKGIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPTYLHQFALLGNIYSRDVLQVE 274
78213893  199 KAEAVYSAGNSGAVMASAIFRLGRLKGIDRPAIGALFPTKDPGKPVLVLDVGANMDCKPTFLHQFALLGNIYSRDVLQVK 278
33866777  188 QALAVYSAGNSGAMMASAIFRLGRLKGIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPAYLHQFALLGNIYSRDVLQVE 267
33860695  223 KAKAVYSAGNSGALMASAIFRIGRLKGIERPAIGALFPTRDQTRPVLVLDVGANTDCKPSYLHQFALLGNVYAKDVLQIE 302
33239609  196 EALSVYSAGNSGALMAAAIFRLGRLAGIDRPAIGALFPTKDPGQPVLVLDVGANMDCKPAYLHQFALLGNIYSRDVLQVQ 275
123965398 321 KPRIGLLNIGEEECKGNDLSLKTFKLLSQEKSFNFGGNCEGRDVLSGNFDVVVCDGFTGNVLLKFLESVGGVLLDILRSE 400
157412491 305 KPRIGLLNIGEEECKGNDLSLKTFELLSSEKSFNFGGNCEGRDVLSGSFDVVVCDGFTGNILLKFLESVGGVLLDILRSE 384
126695492 309 KPRIGLLNIGEEECKGNDLSLKTFELLSSEKSFDFGGNCEGRDVLSGNFDVVVCDGFTGNILLKFLESVGGVLLDILRSE 388
123967689 309 KPRIGLLNIGEEECKGNDLSLKTYELLSSEKSFDFGGNCEGRDVLSGSFDVVVCDGFTGNILLKFLESVGGVLLDILRSE 388
113953618 283 RPRIGLLNIGEEECKGNELALRTHELLREETRLHFAGNCEGRDVLSGEFDVVVCDGFTGNVLLKFLESVGSVLLGVLRAE 362
78183889  275 QPRVGLLNIGEEECKGNELSLKTFELLKEESRLHFAGNCEGRDVLSGEFDVVVCDGFTGNVLLKFLESVGSVLLGVLRSE 354
78213893  279 RPRIGLLNIGEEECKGNDLSLKTHELLRDESRLHFAGNCEGRDVLSGDFDVVVCDGFTGNVLLKFLESVGSVLLGVLRAE 358
33866777  268 QPRIGLLNIGEEDCKGNDLALKTHALLRDERRLHFAGNCEGRDVLSGAFDVVVCDGFTGNVLLKFLESVGSVLLGVLRAE 347
33860695  303 KPRIGLLNIGEEECKGNDLSIKTFELLSNEKSFNFGGNCEGRDVLSGDFDVVVCDGFTGNILLKFLESVGGVLLDILRSE 382
33239609  276 NPRIGLLNIGEEECKGNDLSLRTFELLKEEERLDFVGNCEGRDVLSGDFDVVVCDGFTGNVLLKFLESVGSVLLDVLRAE 355
123965398 401 LPRGRRGKVGSAFLKSNLIRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSALRLAHSAVNHNVMENLNQLQKLQ 480
157412491 385 LPRGRRGKVGSAFLKSNLLRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSALRLAHSAVNHRVMDNLTQLQKLQ 464
126695492 389 LPRGRRGKVGSAFLKSNLLRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSALRLAHSAVNHGVMENLNQLQKLQ 468
123967689 389 LPRGRRGKVGSAFLRSNLLRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSALRLAHSAVNHGVMDNLNQLQKLQ 468
113953618 363 LPRGRRGKVGSAFLRSNLKRIKKRLDHAEHGGALLLGVNGICVIGHGSSKALSVVSALRLAHSAASHGVMDDLAELSKPA 442
78183889  355 LPRGRRGKVGSAFLISNLKRIKKRLDHAEHGGALLLGVNGIAVIGHGSSKALSVVSALRIAHSAASHGVMDDLAALQSGC 434
78213893  359 LPRGRRGKVGSAFLRSNLKRIKKRLDHAEHGGALLLGVNGISVIGHGSSKALSVVSALRIAHSAASHGVMEDLAKLQQGC 438
33866777  348 LPRGRRGKVGSAFLRSNLRRIKKRLDHAEHGGALLLGVNGVAVIGHGSSKALSVVSALRIAHSAASHGVMEDLAALQSGC 427
33860695  383 LPRGRRGKVGSAFLKSNLLRIKKRLDHAEHGGALLLGVNGICVIGHGSSKSLSVVSALRLAHSAVNHNVMENLNQLQKLQ 462
33239609  356 LPRGRRGKVGSAFLRNNLKRIKKRLDHAEHGGALLLGVNGICVIGHGSSKALSVVSALRIAHSAASHGVMDDLAALQPPQ 435
123965398 481 VLNS 484
157412491 465 VLNS 468
126695492 469 VLNS 472
123967689 469 VLNS 472
113953618 443 PLKS 446
78183889  435 D--- 435
78213893  439 D--- 439
33866777  428 D--- 428
33860695  463 VLNS 466
33239609  436 P--- 436
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap