Conserved Protein Domain Family
PRK13844

?
PRK13844: PRK13844 
recombination protein RecR; Provisional
Statistics
?
PSSM-Id: 139904
View PSSM: PRK13844
Aligned: 9 rows
Threshold Bit Score: 378.21
Threshold Setting Gi: 167626338
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89256705    1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
56707920    1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
115315113   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
110670391   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
118497787   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETARAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
167626338   1 MNNQIFSPKITAVIESLRKLPTIGKKSSQRLALYLLDKSPETAITIANSLLDAAENIKKCKYCQSLTEKDVCDICGSQNR 80 
187931732   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
134301666   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
156502866   1 MTSKIFSPKISAVIESLRKLPTIGKKSSQRLALYLLDKSPETAIAIANSLLDATANIKKCVYCQALTEDDVCNICSNTNR 80 
89256705   81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
56707920   81 DNTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
115315113  81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
110670391  81 DNTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
118497787  81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGVGPSELKLDILQRIIADRKIDEVILAISPTVEGETTAHFIS 160
167626338  81 DESKLCIIESMLDLVAIEEAGFFKGKYFVLNGRISPLDGIGPNELKLDILEQIIINREINEIILAISPTVEGETTAHFIS 160
187931732  81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLNILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
134301666  81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
156502866  81 DDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGIGPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFIS 160
89256705  161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNTRTNI 200
56707920  161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI 200
115315113 161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNTRTNI 200
110670391 161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI 200
118497787 161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI 200
167626338 161 QMIGKDIKISRIGFGVPFGGELEYLDQQTLIHAFNARTNI 200
187931732 161 QMIVKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI 200
134301666 161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNARTNI 200
156502866 161 QMIAKDIKISRIGFGVPFGGELEYLDQQTLLHAFNTRTNI 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap