Conserved Protein Domain Family
PRK13842

?
PRK13842: PRK13842 
conjugal transfer protein TrbJ; Provisional
Statistics
?
PSSM-Id: 172369
View PSSM: PRK13842
Aligned: 18 rows
Threshold Bit Score: 376.074
Threshold Setting Gi: 222109218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10955100    1 MPIHSSRPTRLARHAMIAAILLSSTspMPAVAGGVTGQATEWTQLANNTELISLVGKSAEQVNNQITQISQLAEQIQNQL 80 
16119849    1 MPRHFSRPLEAARVAMITAIVILVA--FPTYAGGVTGQATEWTQLANNAELISLVGKSAEQVNNQITQISQLAEQIQNQI 78 
10954833    1 MPRHFSRPLEAARVAMITAIVILVA--FPTYAGGVTGQATEWTQLANNAELISLVGKSAEQVNNQITQISQLAEQIQNQI 78 
47177078   17 MPTRFFPRRRAIAVVICCLVTAGPA--SAGGGGALTGGATEWTQILNNTELVGLVGQSTQQINNQITQITQLAQQIQNQL 94 
92109686    1 MPRRFSPIHRAL----IVAFIIGLPtsGPAFAGAAAGGATEFTQILNNGELVSLVGQSTTQINNQIQQISQLAQQIQNQL 76 
190410136   3 EAIRYLKVRKAVAAVVAIGLVASPK---FSFAGGAVTGATEMTQLLNNGELISLVGQSSEQITNQITQITQLAEQIQNQL 79 
190014717   1 MPKHSSRPLDAARAVMIAAIIIPVAlpVPTHAGGVTGQATEWTQIANNAELISLVGKSAEQVNNQIKQISQLAEQIQNQI 80 
222083318   1 MPIHFSRPIKTARAAMITAIMIPVAlpLPAYAGGVTGQATEWTQLANNAELISLVGKSAEQVNNQITQISQLAEQIQNQI 80 
222080316   1 MPKRSFKLNKVVCVAIGAAGILPIVlpASALAGGVTGQATEWTQLANNTELISLVGKSAEQVNNQITQINQLAEQIQNQL 80 
222109062   1 MPKHFSRPLEAARAAMITAIIVPVAlpFTAYAGGVTGQATEWTQLANNAELISLVGKSAEQVNNQITQISQLAEQIQNQI 80 
10955100   81 NIYRNMLQNTAQLPNHIWGQVENDLKNLQNVVNEGQGVAFSMGNVEDVMKQRFQSFAEMKSNLPDGASFSTTYQNWSGTN 160
16119849   79 NIYKNLLQNTAQLPNHIWGQVENDLSKLQNIVAQGQGVAFSMGNIDDVLKQRFQSFADMKTNLPDGQSFSSTYQGWSDTN 158
10954833   79 NIYKNLLQNTAQLPNHIWGQVENDLSKLQNIVAQGQGVAFSMGNIDDVLKQRFQSFADMKTNLPDGQSFSSTYQGWSDTN 158
47177078   95 RIYENMLQNTARLPTQIWGQVENDLNRLRNIVGQGQGIAFSMGNVDDVLKQRFKSYSDFKTNLPNGSTFSSTWQNWSTTN 174
92109686   77 KIYQNMLQNTAQLPSHVWGQAEGDLKQLQSVVNQGQGIAFSMGNIDDVLKQRFQSYAQFKTSLPNGANFASTYQTWSSTN 156
190410136  80 NIYQNMLQNTAQLPNHIWGQVESDLNQLRDVVNQGQGIAFSMGNADDLLKQRFKSYADLKTNLPNAESFSSSYQTWSNTN 159
190014717  81 NIYNNLLQNTAQLPDHIWGQVENDLKKLQSVVAQGQGVAFSMGNIDDVLKQRFQSFADMKSNLPDGQSFSSSYQGWSDTN 160
222083318  81 NIYKNLLQNTAQLPNHIWGQVENDLNRLQNIVAQGQGVAFSMGNIDDVLKQRFQSFADMKSNLPDGQSFSSTYQNWSDTN 160
222080316  81 NIYRNMLQNTAQLPDHIWGQVENDLKNLQNVVNEGQGIAFSMGNVEDVMKQRFQSFAETKSNLPDGASFSTTYQNWSDTN 160
222109062  81 NIYKNLLQNTAQLPAHIWGQVENDLNKLQNIVAQGQGVAFSMGNIDDVVKQRFQSFADMKSNLPGGQSFSTTYQNWSDTN 160
10955100  161 RDTIAGTLKAANLTSEQFSSEESTMSSLRSMSESSDGQMKALQVGHQIAAQQVAQMQKLRGLVSQQMTMMGTWYQSEQAQ 240
16119849  159 RDTIAGTLKAANLTAEQFSSEESTMSSLRSLSESADGQMKALQVGHQIATQQVAQMQKLRGLVSQQMTMMGTWFQSEQAQ 238
10954833  159 RDTIAGTLKAANLTAEQFSSEESTMSSLRSLSESADGQMKALQVGHQIATQQVAQMQKLRGLVSQQMTMMGTWFQSEQAQ 238
47177078  175 RDTIGASLKAAGLTSDQFTTEEATMSQLRGMSQSADGQMKALQVGHQIAAQQVAQMQKLRGLFAQQVTMMGTWFHSKQAE 254
92109686  157 RDTIAGTLQAAGLTSQQFSTENATMAQLKTASESADGQMKALQVGHEIAAQEVAQMQKLRGLIAQQTTMMATWFQSSQAG 236
190410136 160 RDTISSTLEAASLTADQFGSEEDTMSQLRTMSQSADGQMKALQVGHQIAAQQVAQMQKLRGIVSQQTTMMGTWLQSEQTD 239
190014717 161 RDTIAGTLKAASLTSDQFSSEESTMSSLRSMSETADGQMKALQVGHQIAAQEVAQMQKLRGLVSQQTTMMGTWFQSEQAQ 240
222083318 161 RDTIAGTLKAANLTAEQFSSEESTMSSLRSMSESADGQMKALQVGHQIATQQVAQMQKLRGLVSQQMTMMGTWFQSEQAQ 240
222080316 161 RDTIAGTLKAANLTSEQFSSEESTMSSLRSISESSDGQMKALQVGHQIAAQQVAQMQKLRGLVSQQMTMMGTWYQSEQAQ 240
222109062 161 RDTIAGTLKAANLTAEQFSSEESTMSSLRSMSESADGQMKALQVGHQIATQQVAQMQKLRGLVSQQTTMMGTWFQSEQAR 240
10955100  241 KDLAQARREQFFSGTEHDIRGGQTMEPRW 269
16119849  239 KDLAQARREQFFNAPTNDIRGGQTMEPRW 267
10954833  239 KDLAQARREQFFNAPTNDIRGGQTMEPRW 267
47177078  255 QDLAQARRDGFFTSTAPSTSGGQRMEPRW 283
92109686  237 KDLSQARREQFFNATAPVTSGGQTMEPRW 265
190410136 240 KDLAQARREKFFNADIQSIPTGQKMEPRW 268
190014717 241 KDLAQARREQFFNAPTNDIRGGQTMEPRW 269
222083318 241 KDLAQARREKFFNAPTNDIRGGQTMEPRW 269
222080316 241 KDLAQARREQFFSGTEHDIRGGQTMEPRW 269
222109062 241 QDLAQARREKFFNAPTNDIRGGQTMEPRW 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap