Conserved Protein Domain Family
PRK13838

?
PRK13838: PRK13838 
conjugal transfer pilin processing protease TraF; Provisional
Statistics
?
PSSM-Id: 172365
View PSSM: PRK13838
Aligned: 21 rows
Threshold Bit Score: 271.866
Threshold Setting Gi: 47177066
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16119946    1 MSKRAVIRFLGVAGLVLSGATVMGLIGGYRVNVTPSEPLGLWRVEKLRRPVQSGDLVFVCPPHNAFFEEAWLRGYLRSGL 80 
16519707   13 RRGKPLLLGLATMTMAAVGTISAAWFGGYRINLTPSEPLGLWRIVKIDRPSAVGDLVFICPPRTSAMREARMRGYLRAGL 92 
10954759   13 AQQRRAAGIILVAALVGILAICTALTGGYRINLTPSEPLGLWRIVPLGRPVAVSDLVFICPPATVEMREARARGYLRSGS 92 
47177066    1 ------MSALGLGLGAVAGIAGLGWLGGLRVNTTPSYPLGLWQIVRTNGPIAVGDLVFICMPPGPGLALGLDRGYLRSGL 74 
86359858   13 AQRTNAVVLLALAASIVGGGVAAATVGGFRINMTPSEPLGLWRIVALDRPAVAGDLIFICPPQTTEMREARERGYLRSGT 92 
92109665    2 RRQRSLLVVIATGAGAVLCLALTGWCADLRINMTPSYPRGLWRIEALDRPADVGDRIFICPPDTAVFERAFKRGYIRRGL 81 
116254985  12 TQQRRAIVVMSVAAVAAILLAVTAVAGGYRINLTPSEPLGLWRIIPLDRPAAVDDLLFICPPETAAMREARARGYLRSGS 91 
190404422  13 AQQRRAAVILSATTLAAIVLVATALAGGYRINLTPSEPLGLWRIVPLGRPVAVSDLVFVCPPATAEMREARARDYLRSGS 92 
190410119   1 --------MLGATALFASAVFAAGFGAGLRVNTTPSESLGLWQIEPLSRSAVVGDLVFVCMPDSAARTEGKARGYLRWGL 72 
150377498  13 RRRTPFLLGLAMAPLLFLGAISVASFGGYRINLTPSEPLGLWRFVKLDRPAAVGDLVLVCPPQTAAMQEARRRGYLRAGL 92 
16119946   81 CPGWFAPLIKSVLALPGQRVEIADRIVIDGHPVSASTVSATDSEGRAIAPFAGGVVPPGFLFLHSSFASSYDSRYFGPIP 160
16519707   93 CPGGIAPLIKSVIAVAGQRVEVGVSVNVDGHPVPSSALALRDGQGRPMKPFSGGIVPTDYVFLHSPFSGSYDSRYFGPIP 172
10954759   93 CPGGVAPLIKRVIAIAGQQVEIGASVSVDGREISSSRVTRRDGKGRPLTPSASGTVPAGYVFLHSAFPGSYDSRYFGPVP 172
47177066   75 CPGGAGPLIKRVAAVGGEHIDIARSVTIDGHALAHSCIRLADAEGRALNPYSGSIVPPGHLYLHSDYAGSYDSRYFGPVP 154
86359858   93 CQGGIAPLIKTVIAIAGQHIEIGAGVTIDGRPIAFSELAERDGKGRPMKPFPGGVVPDESVFLLSPFRSSYDSRYFGPLP 172
92109665   82 CAGGLSPLIKTVAAIGGQQIDVAARVSIDGRVLGHSNVRRMDAAGRPLLPFAGGVIPAGALFLHSDFAGSYDSRYFGPIP 161
116254985  92 CPGGFAPLIKTVMAVAGQHVEIGDSVSVDGRGVSSSSLAQRDGKGRPLTPSPSAIIPPGYVFLHSAFPGSYDSQYFGPVP 171
190404422  93 CPGGVAPLIKTVIAVAGQHVEIGASVIVDGRVVASSSLAPRDGKGRPLAPFPSGIVPPGHLFLHSAFPGSFDSRYFGPVP 172
190410119  73 CPGGTGPLIKQVVAIAGQQVAIGGSVSIDGTVLGNSRLVERDGRGRSLHPYSSGIVPPGRVFLHSSFPGSWDSRYFGPVP 152
150377498  93 CPGDVAPLIKTVIAVAGQRVDVCVGVSVNGHPIPSSGLAQRDGQGRPMTEFPGGIVPANYVFLHSRFASSYDSRYFGPVP 172
16119946  161 DSGLLGLARPVFTFDP 176
16519707  173 AAGILGLAQEVLTYAP 188
10954759  173 ASGILGLAQEILTYAP 188
47177066  155 DGGLLGLARPIATFDP 170
86359858  173 ASGILGLAKPVLTYAP 188
92109665  162 ASGILGLARPVLTFDR 177
116254985 172 ASAILGLAQEVLTYAP 187
190404422 173 ASGILGLAQEILTYAP 188
190410119 153 ASGILGIAREVLTYAP 168
150377498 173 ASGILGLAQEVLTYAP 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap