Conserved Protein Domain Family
PRK13836

?
PRK13836: PRK13836 
conjugal transfer protein TrbF; Provisional
Statistics
?
PSSM-Id: 172363
View PSSM: PRK13836
Aligned: 18 rows
Threshold Bit Score: 435.836
Threshold Setting Gi: 222109216
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16519693    1 MAANRAPENPYLAARQEWTERYGSYVRAAAAWRTVGILGLAMAVIGFGYAMYLSTEVKLVPYIVQVDKLGTSVTTGFPEQ 80 
10954769    1 MAANRAPDNPYLAARQEWNERYGTYVKAASAWRIVGILGLTMAVIGFSYAMYLSTQVKLVPYIVEVDKLGTSVTAGFPEQ 80 
116255193   1 MAGHPAPENPYLAARQEWSERYGSYVRAASAWKVVGILSLGMAVIGFGYALYLSTQVKLVPYIVEVDKLGNTVSGGFPQQ 80 
92109683    1 MAARNPPDNPYLAARQEWNERYGSYVKAAATWRVVGIVAMLMAVIGFAYALFESTQVKLVPYIVEVDKLGTAVNAGFPQQ 80 
86359870    1 MAANRAPENPYLAARQEWSERYGSYVQAAAAWRIVGILGLTMAVIGFGYSMYLSTQVKLVPYIVRVDKLGTAVTAGFPEQ 80 
150377490   1 MAVNRTPENPYLAARQEWTERYGSYVKAAAAWRVVGILSLALALVGFSYALYLSTQVRLVPYIVEVDRLGTSVASGFPEQ 80 
190410133   1 MAGHPAPENPYLAARQEWSERYGSYVKAASAWRAVGILSLGMAVIGFGYALYLSTQVKLVPYIVEVDKLGNTASGGFPQQ 80 
190404431   1 MAANRAPDNPYLAARQEWNERYGTYVKAASAWRIVGILGLTMAVIGFSYAMYLSTQVKLVPYIVEVDKLGTAVTAGFPEQ 80 
222109059   1 MAGRTPPDNPYIAARTEWNERYGSYVKAAAAWRLVGVTGMTMAVVGFSYALYQSTQVKLVPYIVEVDKLGTASSAGFPQQ 80 
229557926   1 MSPHSIPENPYLAARQEWNERYGSYVKAAAAWRLVGLTSLVLAVLGTAYGLYQSTQVKLVPYIIEVDKLGNAVNAGYPQQ 80 
16519693   81 IEYADVRVVRATLGNFVTSFRSITPDAAVQKQYIDRTYVLLRTSDPSTEKINAWFRGNSPFEKAKTATVAIEVNNIVALS 160
10954769   81 IEYADVRVVRATLGNFVTSFRSITPDAVVQKQYIDRTYALLRTSDPSTEKVNAWFRGNSPFEKAKSSTVAIEVNNIVALS 160
116255193  81 IEYADTRVVRATLGNFVTSFRSITPDAVVQKQYIDRTYALLRTSDPSTQKVNAWFRGNSPFEKAVNATVAIEVNNIVALS 160
92109683   81 IEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYALLRTSDPATQKINDWFRSNSPFEKARTTTVAIEVNNIVALS 160
86359870   81 IEYADVRVVRATLGNFVTSFRSITPDAVVQKKYIDRTYALLRTSDPSTEKINAWFRGNSPFEKAKSSTVAIEVNNIVALS 160
150377490  81 IEYADARVVRATLGNFVTSFRSVTPDAVVQKQYIDRTYALLRTSDPSTQKINDWFRSNSPFEKARSSTVAIEVNNIVALS 160
190410133  81 IEYADTRVVRATLGNFVTSFRSITPDAVVQKQYIDRTYALLRTNDPSTQKVNAWFRGNSPFEKAVSATVAIEVNNIVALS 160
190404431  81 IEYADVRVVRATLGNFVTSFRSITPDAVVQKQYIDRTYALLRTSDPSTEKVNAWFRGNSPFEKAKSSTVAIEVNNIVALS 160
222109059  81 IEYADPRVVRATLGSFVSNFRSVSPDAVVQKQYIDRTYALLRTSDPATEKINAWFRSSSPFEKAKNATVAVEVNNIVALS 160
229557926  81 IDYADPRVVRATLGAFVANFRSVSPDTVVQKQYIDRTYALLRTADPATEKINSWYRENSPFVKARAATIAIEVNNVVALS 160
16519693  161 NQTYQIDWTEYERDRKGKEIGTRRFRGIATVTLTAPQDEATIRLNPIGLYVRDFDWTAQL 220
10954769  161 NQTYQIDWTEYERDRKGKETGTRRFRGIATVALTAPQDEATIRLNPIGLYVRDFDWTAQL 220
116255193 161 NQTFQIDWTEYERDRKGKEVATRRFRGIATVSITSPQDEATIRLNPIGVYVTDFDWTAQL 220
92109683  161 SQTYQIDWTEFERDRKGKQTGEHRFRGIATVTLTPPQDEQTIRLNPIGLYLRDFDWTAQL 220
86359870  161 NQTYQIDWTEYERDRKGKEIGTRRFRGIATVTLTAPQDEATIRLNPIGLYVRDFDWTAQL 220
150377490 161 NQTYQIDWTEYERDRKGKETGTRRFRGIATVALTAPQDEATIRLNPIGLYVTDFDWTAQL 220
190410133 161 NQTYQIDWTEYERDRKGKEVATRRFRGIATVSITSPQDEATIRLNPIGVYVTDFDWTAQL 220
190404431 161 NQTYQIDWTEYERDRKGKETGTRRFRGIATVALTAPQDEATIRLNPIGLYVRDFDWTAQL 220
222109059 161 NQSYQIDWTEFERDRRGKETATRRFRGIATVTLTPPQDEGVIRLNPIGLYLRDLDWTAQL 220
229557926 161 NQSYQIDWTEFERDRRGKEIATRRFRGVATVTLTPPQDEQTIRFNPIGLYLRDFDWTAQL 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap