Conserved Protein Domain Family
PRK13835

?
PRK13835: PRK13835 
conjugal transfer protein TrbH; Provisional
Statistics
?
PSSM-Id: 172362
View PSSM: PRK13835
Aligned: 18 rows
Threshold Bit Score: 169.122
Threshold Setting Gi: 222109214
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16519695    1 MRKLLISFVTVAILSGCQT-AEDGLTTSSTPTTVTGPAASAIAGDMASRLAEQIGPSa-TMTIKIEKDSSDFASALEAAL 78 
190404429   1 MRKLLALFIAAKLLSGCQT-ADDAMTTNATPVAVTGPAASAIAGDMASRLAEQIGPAsaATTIKMEKDQSEFATALEAAL 79 
190410131   2 KFRRFLPIVFALSLAGCQT-ATDGLSSSTAPADISGPAAGAIAGDMAGRFAEQAGST--ATPIKLHRDTSEFAVALEAAL 78 
150377492   1 MQNLLSTVIAAALLSGCQT-ADQGLRPSSDAGAVTGPAASAIAGDMVSRLAEQIGPAtaTTTIRMDKDTSEFAIALEAAL 79 
86359868    1 MRKLLVIIVAGTLLSGCQT-AEDGLTTSSTPVAVTGPAASAIAGDMASRLAEQIGPAg-ATTLKIQKDSSDFATALEAAL 78 
92109681    7 TRRAILLCIVALSLAGCASfGTGGLVASSAPPDLSGPAASAIAGDLVTKFAEQVGPG--SGTIILKRDGSPFGQALETSL 84 
116255191   2 QLYRLIPIVLTLSLAGCQT-ATDGLSTSGAPAEVTGPAAGAIAGDMAGRFAEQAGST--TTPIKLHKDTSEFSVALEAAL 78 
47177074    4 LRRLIGIATLGLQVAACTAvGGQSFMSSGSRAELSAAAADAIAGDIVSRLAERIGPG--KATIVLKIDDSPFGRALEGSL 81 
10954767    1 MRKLFTFFIAAVLLSSCQT-ADDALTTSSTPVVVTGPAASAIAGDMASRLVEQIGPAgaTTTIKMEKDTSEFATALEAAL 79 
222109057  14 LRGPAAACALALLLSGCQSrGTEELTSSNAPAEISGQAASAIAGDMVSRLAEQIGPG--TTTVSLKQDSSPFGQALEAAL 91 
16519695   79 KGWGYTVVTDGKvgrVGKDVKLVELGYSIDGVDGQVLARLSTPSIALGRAYTATAAGAVPASPLSIMQRN 148
190404429  80 KGWGYTVVTDGK---VAKDIKPVELAFAVEGFDGQVFARVSTPSIALGRAYTPTAAGATPTSPLSIMQRN 146
190410131  79 KGWGFAVVTDEKsanAKDAPKPVELAYSILTADGQVLARLSTDTMELGRAYSVTDGVATPASPISLMKRN 148
150377492  80 KGWGYTVVTDKK---LVRGIKPVELAYAAESFDGQILARLSTPSIAFGRAYTPTGAGAMPASPLSILQRN 146
86359868   79 KGWGYTVVKDGK---VGKDVKPVELAYSLDGVDGQVLAQLSTQSIVLGRAYTTTAAGATPASPLSIIQRN 145
92109681   85 KSWGYAVATDQK----TGGEKTIPLAYVIASYNGQILARLSTAHVELGRTYAATTAGASPASPLSVMRRG 150
116255191  79 KGWGFAIVTDDKsasVKDAPKPVELAYSIATVDGQVLARLSTDTMELGRAYSVNNGLATPASPLSLMKRN 148
47177074   82 RRWGYAVATDQK-----ADERAIALAYVVDTYDGTVLARLTTPQFALGRAYKVTATGASPSSPVSVLERG 146
10954767   80 KGWGYTVITDGK---VGKDVKPVELAYAIEGLDGQLLARVSTPSIALGRAYTPTAAGATPASPLSIMQRN 146
222109057  92 KGWGYAVVTDQK---TDGAARTVPLAYVVIPFEGQLLARLSTNSVELGRAYTVTTTGAQPASALSVMKRG 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap