Conserved Protein Domain Family
PRK13834

?
PRK13834: PRK13834 
putative autoinducer synthesis protein; Provisional
Statistics
?
PSSM-Id: 172361
View PSSM: PRK13834
Aligned: 16 rows
Threshold Bit Score: 376.328
Threshold Setting Gi: 229557927
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16119854    1 MRILTVSPDQYERYRSFLKQMHRLRATVFGGRLEWDVSIIAGEERDQYDNFKPSYLLAITDSGRVAGCVRLLPACGPTML 80 
16519684    1 MQILAISKPRNIEEAQLLRSHHELRARVFSDRLGWEVNVVGGCESDTFDDLQPTYILAVSSNDRVVGCARLLPALGPTMV 80 
10954777    1 MQVLAISTPKNIQEAELIHRHHELRARVFADRLGWDVEVIDGLELDAFDTLIPTYILAISDSRQVAGCARLLPAPGPTMV 80 
116254989   1 MQVLALSTPRTLQDAHLLHMHYQLRARVFSDRLGWEVDVSAGCESDGFDALRPTYVFAVAGTGQPAGCARFLPTLGPTMV 80 
92109691    1 MRAIAIDANEDSGMRSLLDGMHQLRARVFPGWLGWQVRIEQGHERDEYDALGPTYILALTDHGDVAGCARLLPTIDPNML 80 
86359877    1 MQVVAFSTPRTIEEAHLLHSHHQLRARVFSARLGWEVDVTAGCESDNFDALRPTYVLAIAGTGQLAGCARLLPALGPTMV 80 
190404439   1 MQVLAISTPKNIQEAELIHRHHELRARVFADRLGWDVEVIDGVELDAFDTLIPTYILAISDSRQVAGCARLLPAPGPTMV 80 
190014722   1 MRILTVSPDQHERSQSLLNQMHRLRAEVFGGRLDWDVSITRGEERDRYDDCKPTYLLTIAMCGLIAGCVRLLPACGPTML 80 
222080321   1 MLILTVSPGQYEHQTTYLKQMHRLRAEVFGNRLEWDVAIEDGGERDQYDALSPTYILATLSGQRVVGCARLLPASGPTML 80 
229557927   1 MRAIAITADKTAASQQLLKEMHRLRARVFGGRLGWDVEIVEGSESDHFDDLNPVYILVLGDGGAVLGCARLLPATGPTML 80 
16119854   81 EQTFSQLLEMGSLAAHSGMVESSRFCVDTSLVSRRDASQLHLATLTLFAGIIEWSMASGYTEIVTATDLRFERILKRAGW 160
16519684   81 ANVFPSLLSAGHLNAHSSMVESSRFCVDTFLAESRGDGSIHEATLTMFAGIIEWSVANRYTEIVTVTDLRFERILARVGW 160
10954777   81 ADVFHSLLPNGRLNAHAAMIESSRFCVDTALGEGRGDGSVHEATLTMFAGIIEWCMSNGFTEIVTVTDLRFERILARVGW 160
116254989  81 ADVFPSLLPDGQLNGHAAMIESSRFCVDTTLAEGRGNGSVHEATLTMFAGIIEWCMANGYTEIVTVTDLRFERILARVRW 160
92109691   81 SQTFPQLLASGRLRAKPTRIESSRFCVDSQ-REGRGGRCLHEAILTMFAGVIEWSMSNGYDEIVTATDVLFERILQRAGW 159
86359877   81 TDVFPALLPEGQLNAHAAMIESSRFCIDTSLGEGRGVGSVHEATLTMFAGIIEWCMSNGYTDIVTVTDLRFERILARVGW 160
190404439  81 ADVFHSLLPNGRLNAHSAMIESSRFCVDTALGEGRGDGSVHEATLTMFAGIIEWCMSNGFTEIVTVTDLRFERILARVGW 160
190014722  81 EQTFPELLEAGSLGAHPGMVESSRFCVDTTLPTGRAGGQLHLATLTMFAGIIEWSMANGYDEIVTATDLRFERILKRAGW 160
222080321  81 ERTFPQLLAAGSLSATTAMVESSRFCVETTLPTRRAGGQLHLATLTMFAGIIEWSMANGYDEIVTATDLRFERILKRAGW 160
229557927  81 VDAFPQLLADGRLDAHPRMIESSRFCVDTGALEAMTARGLHRATLTLFAAIIEWSIGEGYRDIVTATDVRFERLLVRARW 160
16119854  161 PMRRLGEPTAIGNTIAIAGRLPADRASFEQVCPPGYYSipriDVAAIRSAA 211
16519684  161 PLQRIGEPRPIGATVAVAGTLPAKADTFMRLRPANYRS----QIISTFGQS 207
10954777  161 PLQRLGEPRKFGVTMAVAGILLADASTFQKLRPANYRS----EFTSLSKAA 207
116254989 161 PLQRLGEPKKIGVTMAVAGTLRANADTFLRLRPWE-------ETCAIFTGY 204
92109691  160 PMTRLGGVELIGETMSVAGILPADRTSFEQVYPPGYCS----DLRRLKRAA 206
86359877  161 PLQRLGEPKKIGVTMAVAGILPVNASMFLRLRPSDYRS----ELSSVSKAA 207
190404439 161 PLQRLGEPRKFGVTMAVAGILLADASTFQKLRPANYRS----EFTSLSKAA 207
190014722 161 PMTRLGEPVAIGNTVAIAGRLPADRMSFERVCPPGYRSiiadDNGRPFRSA 211
222080321 161 PMTRLGEPVVIGNTVAVAGHLPADRMSFERVCPPEYRSiiadDNGRPFRSA 211
229557927 161 PMRRLGEPQMIGETLSVAGTLPADEVSFAMVRPPGYRS----ELGVTRRSA 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap