Conserved Protein Domain Family
PRK13833

?
PRK13833: PRK13833 
conjugal transfer protein TrbB; Provisional
Statistics
?
PSSM-Id: 172360
View PSSM: PRK13833
Aligned: 17 rows
Threshold Bit Score: 521.665
Threshold Setting Gi: 222109222
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150377483   1 MTQLRSHPRLVRKLQEALGDQLCVALDDASVVEIMLNPDGKLFIDRLGDGVALAGEMSSAAAEIVVGTVAHALQSEVDRE 80 
190410141   1 --MLQSHSRLVRKLQDALGERLCIALDDPTVVEIMLNPDGKLFIERLGHGVAPAGEMQATAAETVIGSVAHALQSEADGE 78 
86359876    1 MNQLRSHPRLVRKLQEALGDQLCVALDDSTVVEIMLNPDGKLFIERLGHGVAPAGEMSSAAAEMVIGTVAHALQSEVDTE 80 
92109690    8 MAELRSHPRLVRKLHDALGDQICAALDDTSVVEVMLNPDGRLFIERLGQGMASAGTMAAATAEIIIGSVAHALRSEADDE 87 
116255199   1 --MLQSHSRLVRKLQDALGEHLCIALEDPTVVEIMLNPDGKLFIERLGHGVAPAGEMQATAAETVIGSVAHALQSEADGE 78 
47177082    1 -MQLRSHPRLVRKLQEAFGDTICAALDDPSVVEVMCNPDGQLFVERLGQGVTRVGEMSSAAAEIIIGSVAHALNSEVDDE 79 
10955104    1 MTQLRSHPRLVRKLQDSLGDQLCVALDDATVVEIMLNPDGRLFIERLGHGVVAAGAMTPAAAEVVIGSVAHALQSEADDE 80 
10954776    1 MNQLRSHPRLVRKLQEALGDQLCVALDDATVVEIMLNPDGKLFIERLGHGVAPAGEMSSAAAEMVIGTVAHALQSEVDTE 80 
16519685    1 MEQLRSHPRLVRKLQEALGDQLCVALDDSNVVEIMLNPDGKLFIERLGHGVAPAGEMSSAAAEMVIGTVAHALQSEVDTE 80 
222080320   1 MTQLRSHPRLVRKLQDALGDQLCVALDDATVVEIMLNPDGRLFIERLGHGVARAGAMTPSAAEVVIGSVAHALQSEADDE 80 
150377483  81 QPIISGELPIGGHRFEGLLPPVVARPAFAIRRRASRLIPLEDYVRTGVMTEDQVSTIRSAISSRLNIIISGGTGSGKTTL 160
190410141  79 RPIISGELPIGGHRFEGLLPPVVNSPTFTIRRRASQLIPLDDYVTTKIMTEAQASIIRSAIANRLNIVIAGGTGSGKTTL 158
86359876   81 QPIISGELPIGGHRFEGLLPPVVAKPAFTIRRRALRLIPLDDYVRSAMMTEHQASTIRSAISSRLNIIISGGTGSGKTTL 160
92109690   88 RPIISGELPIGGHRFEGLLPPVVGGPAFTIRKRASRLFDLDDYVTQGVMTADQVAVVRNAIVSRLNIVVSGGTGSGKTTL 167
116255199  79 RPIISGELPIGGHRFEGLLPPVVNSPTFTIRRRASRLIPLDDYVTAKIMTEAQASIIRSAITNRLNIVIAGGTGSGKTTL 158
47177082   80 RPIVSGELPIGAHRFEGLLPPVVSAPAFAIRRRASRVIPLAAYVRDRIMTERQARMIRHAVSSRMNIVVSGGTGTGKTTL 159
10955104   81 RPIISGELPIGGHRFEGLLPPIVSGPAFTIRRRASRLIPLDDYVTSKVMTEAQASAIRSAIDSRMNIVISGGTGSGKTTL 160
10954776   81 QPIISGELPIGGHRFEGLLPPVVAKPAFTIRRRASRLIPLEDYVRTGVMTEYQASTIRSAISARLNIVISGGTGSGKTTL 160
16519685   81 QPIISGELPIGGHRFEGLLPPVVAKPSFTIRRRASRLIPLDDYVRSGVMTEAQAATIRSAIDSRLNIIISGGTASGKTTL 160
222080320  81 RPIISGELPIGGHRFEGLLPPIVSGPAFTIRRRASRLIPLDDYVKSKVMTEAQASAIRSAIDSRMNIVISGGTGSGKTTL 160
150377483 161 ANAVIDEIVKTRPDDRLVILEDTAEIQCAAQNAVLLHTSDKVDMARLLKSTLRLRPDRIVVGEVRDGAALTLLKAWNTGH 240
190410141 159 ANAVIAEIVSAAPDDRMVILEDTSEIQCAADNALCLHTSDSVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 238
86359876  161 ANAVIAEIVKSAPEDRLVILEDTAEIQCAADNAVLLHTSDTVDMARLLKSTMRLRPDRIVVGEVRDGAALTLLKAWNTGH 240
92109690  168 ANAVIAAIVAHAPEQRLVILEDTAEIQCAAENAVSLHTSDTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 247
116255199 159 ANAVIAEIVSSAPEDRMVILEDTSEIQCAAENAVCLHTSDAVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 238
47177082  160 TNAVIAEMVASTPEHRVVIPEDTTKLQCVAENAVALHTTDTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 239
10955104  161 ANAIIAEIVTAAPDDRLVILEDTAEIQCAAENAVSLHTSDTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 240
10954776  161 ANAVIDEIVKSAPEDRLVILEDTAEIQCTAENAVLLHTSDTIDMARLLKSTMRLRPDRIVVGEVRDGAALTLLKAWNTGH 240
16519685  161 ANAVIHEIVRSAPEDRLVILEDTAEIQCAADNAVLLRTSDTVDMARLLKSTMRLRPDRIVVGEVRDGAALTLLKAWNTGH 240
222080320 161 ANAIIAEIVAAAPDDRMVILEDTAEIQCAAENAVSLHTSDTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGH 240
150377483 241 PGGAATIHSNTAMSALRRLEQLTAEVSQQPMHEVIGEAVDLIVSIERTPRGRRVRDVIRVERFAGGEYeiESDQLTEEQE 320
190410141 239 PGGVTTIHSNTAMSALRRLEQLTSEASQQPMQAVIGEAVDLVISIERAGRGRRVREVLHVEGFNGSRY--QTEHYPQIDE 316
86359876  241 PGGVATIHSNTAMSALRRLEQLTAEASQQPMHEVIGEAVDLIVSIERTPRGRRVRDVIQVERFAGGQYeiESDQLTEEQE 320
92109690  248 PGGITTIHANSAHSALRRLEQLTAEASQQAMREVIGEAVDLIVSIERTDRGRQVRDVLHVESYSAGQY--QTESCAR-KE 324
116255199 239 PGGVTTIHSNSAMSALRRLEQLTSEASQQPMQAVIGEAVDLVISIERAGRGRRVREVLHVEGFNGSRY--QTEHYPQIDE 316
47177082  240 PGGITTIHANSAQSALTRLEQLTAEASQQPMQAVIGEAVDLIVSIEKTARSRVVRDILQVEGFAHGEY----RFQSCTEE 315
10955104  241 PGGVTTIHSNTALSALRRLEQLTAEASQQLMQEVIGEAVDLIVSIERSGKGRRVREVIHIEGYRNNHY--QTEHYAQIEE 318
10954776  241 PGGVATIHSNTAMSALRRLEQLTAEASQQPMHEVIGEAVDLVISIERTPRGRLVRDIIQVERFINGRYeiESDQLTEEQE 320
16519685  241 PGGVATIHSNTATSALRRLEQLTAEASQQPMHEVIGEVVDLIVSIERTPRGRRVRDIIQVERFANGRYeiESDQLTEERE 320
222080320 241 PGGVTTIHSNTAMSALRRLEQLTAEASQQPMQEVIGEAVDLVVSIERSGKGRRVREVIHIEGYRNSHY--QTEHYAQIDE 318
150377483 321 ARHVA 325
190410141 317 DSHAA 321
86359876  321 ARHVA 325
92109690  325 QRHVA 329
116255199 317 DSHAA 321
47177082  316 EQRVA 320
10955104  319 DSHVA 323
10954776  321 ARHVA 325
16519685  321 ERHVA 325
222080320 319 DSHVA 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap