Conserved Protein Domain Family
PRK13831

?
PRK13831: PRK13831 
conjugal transfer protein TrbI; Provisional
Statistics
?
PSSM-Id: 172358
View PSSM: PRK13831
Aligned: 18 rows
Threshold Bit Score: 714.588
Threshold Setting Gi: 222109213
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16119843    1 MVQSLKLGGTAQEEEAvSGMRRINRLPIIIVVVLVVAFLGVIFYGLTSRGLYFRgDEGPDTSSGNPASTFADQIKRGVSD 80 
190404428   1 MVQSLQLGAPAQSDDQ-NGMRRLNRLPIIIAIIVVALFVGVVVIGLSLRGLSFHrG-DIEGASNTPATSFGDQLKRGVTD 78 
190410130   1 MVQSLQLGTANQSADE-KGMKRLNRVPLFFGIGILVLFLAVLVYGLSSRGLRFGqQNPNESNSTTPASTFADQLKRGVKD 79 
150377493   1 MVQSLQLGASSHADDQ-KAMRRLNRLPIFVAITVIVLFFAVVVIGLSWRGVSLKrGDDTQSISNTPATSFGEQLKRGVTD 79 
86359867    1 MVQSLQLGASNQADDQ-KGMRRLNRLPVIIAIVIIALFVGVVVIGLSWRGLPFNrNIELDSASNAPATNFGDQLKRGVTD 79 
116255190   1 MVQSLQLGTSNQSADE-KGMKRLNRVPLFVGIGILVLFLAVLVYGLSSRGLRFGqHDPNESGSGTPASTFADQLKRGVKD 79 
92109680    1 MAQSLKLGGTPEGEEA-RGIRRLNQLPIIVAIVLVIVFFAVIFYGLTSRGLYVHrAAGIDTASSSPATTFADQLKKGISN 79 
47177073    1 MTQSLDLNGAAPNG---PKMRRLNRLPVIVAIVLAVLFFGVIFYGLSTRGLYFRgDRQADGLSSGSASTYADQMKRGVPN 77 
16519696    1 MVQSLRLGAANEAEDQ-NGMRRLNRLPIIVAIVIVALFVGFVVIGLAWRGLPFNrNNDIHSASNTPATNFGDQLKRGVTD 79 
10954766    1 MVQSLQLGAPAHANDQ-NSMRRLNRLPIIIAMIVIALFVGVVVIGLSLRGLSFNrG-DIEGASNTPATSFGDQLKRGVTD 78 
16119843   81 GIIGEPQQVT-TLQPTPVETQGEKRAVNPFTPQPGQREEARPeaQLESEQVWRARLQREQEEQYLRERQRQRMARLQAND 159
190404428  79 GIIGEPEKQE-VFQPTPVVEQKVEKQETAVERRPNDRQERRS---LESEEEWKARLKREQDEQYIREAQRQRMARLQARA 154
190410130  80 GIIGDREEPQpVFQPTPVPQQQTDTRPVEAEPKVEPREQRRP--RMESDEEWNARMLREQREQIFREQQRQRMASLQAKG 157
150377493  80 GIIGEPVERE-AFQPTPVV-HKVDTQESVVERRPGERKERRP--KLESEEEWKARLKREQDEQYIREAHRQRMARLQAHA 155
86359867   80 GIIGEPVERE-AFQPTPAVEQKAEKETPIVDRRPTEREERRP--RLESEEEWKARLKREQDEQYFREAQRQRMARLQARA 156
116255190  80 GIIGDREEQQpVFQPTPVPQQQGDTRPVQTEPKIEPREPRRS--RMESDEEWNARMLREQREQIFREQQRQRMASLQARG 157
92109680   80 GIIGDQSEAQ-AFQPAPQ----SEAPKPPSNPLAGRQQAEASasTLEREAVWRARLEREAHEQYLRERQRERMARVQAND 154
47177073   78 GIIDDPNATQ-VLQPTPPVAP-ERPAANPFTPARESQTQQAA---METEEAWRLRMQREQQEQFMREQQRQRMARYQANG 152
16519696   80 GIIGEPVKRE-AFQPTPTMKQKVDKEPTVVD-RPTEPEERRP--RLETEEEWKARLMREQDEQIIREAQRQRMARLQARA 155
10954766   79 GIIGEPEKQE-VFQPTPVVEQKVEKQEPVVERRPNDRQERRS--TLESEEEWKARLKREQDEQYMREAQRQRMARLQARA 155
16119843  160 AAYDSPIAVDRGKFNEREANTNDTAAATTSGASTAmtpGASDLYAAALRAGLGGQNGDPNGQKSKEDFFNADLKELGYLP 239
190404428 155 TALDSPLKVDIGDFEKATSTNDSGRQPTNAAVN-----SASDLYAAAMKSGLMGQNVDQNGQPSKEDFFNQDIKDLGYLP 229
190410130 158 AALDSPLKVDISDVAAQAQGASSTGPRQSNVGAT----GSQDLYAAALRAGAAGQ-IDQNGQASKEDFFTADIKDLGYLP 232
150377493 156 TALDSPLKVDVSDIKNSTNHANTRQSRNLEAK------GASDLHAAAMKSGLISQQVDPNGQISKEEFFNKEIKDLGYLP 229
86359867  157 TALDSPLKVDISDVEKAANNSTDASRQTTTATAN----NASDLYAAAMKSGLMGQNVDQNAQGSKEDFFNQDIKDLGYLP 232
116255190 158 AALDSPLKVDITDVSAQAPGAASAAPRQSNTAPN----GSQDLYAAALRAGAAGQ-VDQNGQASKEDFFNADIKDLGYLP 232
92109680  155 AAYDSPLALNLGKLQTSTAPTSGGAPSKATSTPGFa-gGANDLYAAALRAGFGTQNIDPNGQGAKEDFFNADLKKLGYLP 233
47177073  153 AAYDSPLAINLAKLQTNVATASGPATAPASAPGVArptGAADLYAAAMRAGL-GQPVDPNGQTNKESFINQDLKKLGYVP 231
16519696  156 TALDSPLKVDISEGEKAPKNSTDTGQNPTATEN-----NASDLYPAAMKSGIMGENLDPNAQASKEDFFNQDIKDDGYLP 230
10954766  156 TALDSPLKVDIGDVEKATNSTNDTGRQPTNTAAN----SASDLYAAAMKSGLMGQNVDQNGQTSKEDFFNQDIKDLGYLP 231
16119843  240 NRVVPQQSLYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHLLLIPQGTKLFGRYDSKVSFGQSRVLVVWTD 319
190404428 230 NQVVPQMSPYELKRGSVIPATLITGLNSDLPGRITAQVSQNVYDSASGYRLLIPQGAKLFGRYDSKVSFGQERVLVVWTD 309
190410130 233 NRVVPQQSRYELKRGSVIPATLITGISSDLPGRITAQVSQNVYDSSTGHFMLVPQGTKLFGRYDSKVSFGQNRALVVWTD 312
150377493 230 NQVVPQLSPYELKRGSVIPATLITGLNSDLPGRIAAQVSQNVYDSATGYRLLIPQGAKLLGRYDSKLSFGQERVLVVWTD 309
86359867  233 NQVVPQMSPYELKRGSVIPATLITGLNSDLPGRISAQVSQNVYDSATGYRLLIPQGAKLFGRYDSKVSFGQERVLVVWTD 312
116255190 233 NQVVPQQSRYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHFMLVPQGTKLFGRYDSKVSFGQNRALVVWTD 312
92109680  234 NKVVAPTSAYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSATGHDLLIPQGTKLLGRYDSKISFGQSRVLVIWTD 313
47177073  232 NSVVPQRSPYELKRGSIIPATLITGINSDLPGRITAQVSQNVFDSATGHHLLIPQGTRLLGRYDSKVTFGQSRVLVVWTD 311
16519696  231 NRVVPQMSVYELKRGSVIPATLITGLNSDLPGRITAQVSQNVYDSATGYRLLIPQGAKLFGRYDSKVSFGQERVLVVWTD 310
10954766  232 NQVVPQMSPYELKRGSVIPATLITGLNSDLPGRITAQVSQNVYDSATGYRLLVPQGAKLFGRYDSKVSFGQERVLVVWTD 311
16119843  320 IIFPNGSTLQIGGMAGTDAQGYSGSRDKVDRNWLQTFGSAILIAVIGTGIDMAVP-ESSTLATQDTASDAARRNFAETFG 398
190404428 310 LIFPNGSTLQIGGMAGTDAEGYGGFQDKVDRHLWRTFGSAALVAIIGTGIDMSMP-ESSTLATQDTASDAARRNFAESFG 388
190410130 313 IIFPNGSTLQIGGMAGTDSEGYGGFSDKVDNHYLRTFGSAALVALIGTGIDMSMP-ESSTLATQDTASDAARRNFAETFG 391
150377493 310 LIFPNGSTLQIGGMAGTDAEGYGGFKDKVDRHLWRTFGSAALVAIIGTGIDMSLP-ESSTLATQDTASDAARRNFAESFG 388
86359867  313 LIFPNGSTLQIGGMAGTDAEGYGGFKDKVDRHLWRTWSSAALVALIGTGIDMSMP-ESSTLATQDTASDAARRNFAESFG 391
116255190 313 IIFPNGSTLQIGGMAGTDSEGYSGFSDKVDNHYLRTFGSAALVALIGTGIDMSMP-QSSTLATQDTASDAARRNFAETFG 391
92109680  314 IIFPNGATLQIGGMAGTDSEGYGGFNDQVDNHYFKVFGSAILIAAIGAGIDMSVP-ASSPYGYRQTPTDAARNSFAETFG 392
47177073  312 IILPNGSTLQIGAMAGSDAEGYGGFKDQVDNHYFQIFGSAILIAAIGAGTEMAIPrDRSAFGMENSAEYAARRSFVETFG 391
16519696  311 LIFPNGSTLQIGGMAGTDAEGYGGFKDRVDRHLWRTWSSAALIALIGTGIDMSMP-ESSTLATQDTASDAVRRNFAESFG 389
10954766  312 LIFPNGSTLQIGGMAGTDAEGYGGFQDKVDRHLWRTFGSAALVAIIGTGIDMSMP-ESSTLATQDTASDAARRNFAESFG 390
16119843  399 RVADRTIQRNMDVQPTLEIRPGYKFNVLVDQDIVFPGAYR 438
190404428 389 RVTEQTISKNLNVQPTIRIRPGYKFNVLADQDIIFPSIYS 428
190410130 392 RVAEQTISKNLNVQPTIKIRPGYRFNVLVDQDIIFPGVYS 431
150377493 389 RVAEQTISKNLNVQPTIRIRPGYKFNILVDQDIVFPSVYN 428
86359867  392 RVAEQTISKNLNVQPTIQIRPGYKFNVLVDQDIIFPQAYR 431
116255190 392 RVAEQTISKNLIVQPTIKIRPGFRFNVLVDQDIIFPGNYS 431
92109680  393 RVAEQTISKNLNVQPTLEIRPGYVFNVLVDQDMVFLGAYR 432
47177073  392 RVAERTISKNMDVQPTLEIRPGYKFNVLVDQDMVFPSAYR 431
16519696  390 RVAEQTISKNLNVQPTIRIRPGYKFNVLVDQDIIFPSAYR 429
10954766  391 RVAEQTISKNLNVQPTIRIRPGYKFNVLVDQDIIFPSVYS 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap