Conserved Protein Domain Family
PRK13817

?
PRK13817: PRK13817 
ribosome-binding factor A; Provisional
Statistics
?
PSSM-Id: 139879
View PSSM: PRK13817
Aligned: 5 rows
Threshold Bit Score: 182.64
Threshold Setting Gi: 154707600
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154707600   1 MSQRQQRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQAT 80 
29654722    1 MSQRQQRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQAT 80 
161830027   1 MSQRQQRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQAT 80 
212218230   1 MSQRQQRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQAT 80 
212212199   1 MSQRQQRVADLIHQQLAELLKKEVRDSRLSKISLTAVSISPDLKQAKVFYSLLENQNEKEVQKALNKATGYLRHLLAQAT 80 
154707600  81 VLRYVPKLEFVYDESIERAHRISLLIERALKKDDSDESS 119
29654722   81 VLRYVPKLEFVYDESIERAHRISLLIERALKKDDSDESS 119
161830027  81 VLRYVPKLEFVYDESIERAHRISLLIERALKKDDSDESS 119
212218230  81 VLRYVPKLEFVYDESIERAHRISLLIERALKKDDSDESS 119
212212199  81 VLRYVPKLEFVYDESIERAHRISFLIERALKKDDSDESS 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap