Conserved Protein Domain Family
PRK13815

?
PRK13815: PRK13815 
ribosome-binding factor A; Provisional
Statistics
?
PSSM-Id: 172345
View PSSM: PRK13815
Aligned: 6 rows
Threshold Bit Score: 212
Threshold Setting Gi: 118579400
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222055782   1 MFKRSEKVAEAVHELVSELLVKGLKDPRIGFVTITGVKVTDDMHLATIYFTVIGSDEEKKATEQGLNSARGFIRKEMGKS 80 
148263959   1 MFKRSEKVAEAVHELISELLVKGLKDPRIGFVTITGVKVTDDMHLATVYFTVIGSDAEKKATEQGLNSARGFIRKEMGKS 80 
118579400   1 MSKRSEKLAETIHETISSILSRGLNDPRIGFVTLTAVDVVEDLSIARIYFTAIGDRDARKNSEAGLNSAKGYLRRELGKV 80 
78222797    1 MYKRSDKVAEAIHELVSGLLVKGLKDPRIGFVTITGVKVSDDIRHATIYYTVMGSDEAKKSTLHGLNSSVGFIRKEVSKE 80 
39996689    1 MFNRSEKVAEAIHELVSGLIVKGMKDPRIGFITITGVKVTDDIRQATIYYTVMGDDEARVSTARGLASATGFLRREIGKQ 80 
189424729   2 KHKRSDKVAETIHTTISTILSRGLNDPRIGFVTITGVEVTDDLHLARIFFTVIGDEAAKKSSEAGLNSAARFIRHELGKV 81 
222055782  81 FRMRYVPDIVFKYDASVEYGSRIESILKEIGSpEHDDNDKENS 123
148263959  81 LRMRYVPDIVFKYDVSVDYGYRIESILKEISS-SEQSDDKQDS 122
118579400  81 LTIRHIPELIFKYDESQEYGNRIDSILREIAT-EHDRDDSEHS 122
78222797   81 LRLRFAPELIFKYDESIEYGNRIDQLLKEIGS-EEGGND---- 118
39996689   81 LRLKFAPELHFKYDQSIEYGNRIDQLLKEIET-EKGSDD---- 118
189424729  82 LKMRYTPDILFKYDHSQEYGQRIDDLLREVGT-GNDGNDSEDR 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap