Conserved Protein Domain Family
pyrB

?
PRK13814: pyrB 
aspartate carbamoyltransferase
Statistics
?
PSSM-Id: 139876
View PSSM: PRK13814
Aligned: 5 rows
Threshold Bit Score: 618.272
Threshold Setting Gi: 29655373
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29655373    1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80 
161831597   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80 
154705998   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80 
212219593   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVVNLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80 
212213539   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80 
29655373   81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
161831597  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
154705998  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
212219593  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
212213539  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
29655373  161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
161831597 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
154705998 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
212219593 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
212213539 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
29655373  241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
161831597 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
154705998 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
212219593 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
212213539 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap