Conserved Protein Domain Family
PRK13799

?
PRK13799: PRK13799 
unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional
Statistics
?
PSSM-Id: 106740
View PSSM: PRK13799
Aligned: 2 rows
Threshold Bit Score: 1140.51
Threshold Setting Gi: 152981424
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160897552   1 MALTLEQLNAADLATAASLLDGLYEHSPWIAEAALAQRPFRSLAQIKYAMAQVLDKAPVQAKLDLIRAHPELAGKAMETN 80 
152981424   3 TLEQLNRLAAQDVPAFVDTLRGIYEHSPWIPERAAKLGPFPTITALKQALQGVVSAADRAEQLQLIRAHPELAGKAAIAG 82 
160897552  81 TLTAESTNEQNKAGLTRCTPEELEHIRKLNAEYGKRFGFPFILAVRGPRGAGLAKAEIIETFERRLHNHPDFELGEALRN 160
152981424  83 ELTVESTGEQAKAGLNLCTPEEFAALQNLNNDYNKKFGFPFILAVKGATGKGLTRQQIIATFTRRLRNQVEDELREALRQ 162
160897552 161 IHRIAEIRLNDKFGYTPELGNDVWDWQEKLAQHSDpgyaEKGQLTVTYLTDAHRACAQRISHWMRDCGFDeVEIDAVGNV 240
152981424 163 IGRIAEMRINDLLGYTPAIGALVMDWAEDIAAWSE----DEGALTCTYMSDAHRRTANQISDWMRTAGMH-VHIDAVGNV 237
160897552 241 VGRYKAATDDARTLLTGSHYDTVRNGGKYDGRLGIFVPMACVRELHRQGKRLPFHIEVVGFSEEEGQRYKATFLGSGALI 320
152981424 238 VGRYLATDPRAKTLITGSHYDTVRNGGKYDGREGILLAIAVVKHLHERGETLPFHFEVIAFAEEEGVRFKSTFLGSNAVI 317
160897552 321 GDFRQEWLEQKDADGITLREAMQHAGLCIDDIPKLQRDPARYLGFIEVHIEQGPVLNELDIPLGIVTSINGSARYICEMI 400
152981424 318 GQFNMELLDITDRDGISMREAITQAGHDVNAIPQIARNPADVLGYVEVHIEQGPVLLQRDLPVGIVTSIAGSSRYQVEFR 397
160897552 401 GMASHAGTTPMDRRRDAACGVAELALYIEKRAARD--GTSVATMGQLNVPSGSVNVVPGRCQFSLDLRAPTNEQRDAMVA 478
152981424 398 GVASHSGTTPMSMRKDAAAAAAEIILYVEQRCAQDqhASLVGTVGQLQVPSGSTNVIPGRCVFSLDIRAAVDSIREAAVA 477
160897552 479 DILAEIEAIAQRRGLRYSTELAMKAAAAPSAPEWQQRWEAAVDALGVPLYRMPSGAGHDAMKLHEIMPQAMLFVRGLNAG 558
152981424 478 DILQHIADVCARRNIEYKAELSVSAPAAPCAPWLMKQLSAATERAGVRPFELASGAGHDAMTIAKMTDVAMLFTRCGNGG 557
160897552 559 ISHNPLESSTADDMQLSVDAFSHVLNQLAQE 589
152981424 558 ISHNPLETMTADDTEVSAQILLDFLRNFKEK 588
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap