Conserved Protein Domain Family
PRK13797

?
PRK13797: PRK13797 
allantoicase
Links
?
Statistics
?
PSSM-Id: 106738
View PSSM: PRK13797
Aligned: 4 rows
Threshold Bit Score: 812.665
Threshold Setting Gi: 162454153
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158317428   1 MTDAPDLTNLVDLAAARFGGSVVAVNDEFFALAERMLLAEAPIVRPGVFTERGQWTDGWETRRRRDLPAADWAIVRLGAP 80 
111220914  14 MSDEPDLTNLVDLAAARSGGTVVAVNDEFFAFAERMLLPEPPVVRPGVFTERGQWTDGWETRRRRDLPGADWAIVRLGAP 93 
86739553    1 MSDAPDLTNLVDLAAARFGGTVVAVNDEFFAFAERMLLPEPPIVRPGVFTERGQWTDGWETRRRRDLPGSDWAIIRLGSP 80 
162454153   6 GVTGPAFAEALDLASERLGGAVLAANDEFFAPKENLLKAGKAVFLEHEYTDRGKWMDGWETRRRRT-PGFDWCLVRLGLP 84 
158317428  81 GIVHAVTVDTTHFTGNAPESVELHGATLAGYPSAEDVAEDSVTWVPLVARTPVAADAVNVLPVSAEGRLRISHLRLTIHP 160
111220914  94 GIAHAITVDTTHFTGNAPEAVEIHGATVAGYPSAAEVADDAVDWVELVPRTPITADAVNVLPVAEAGRLRITHLRLTIHP 173
86739553   81 GIAHAVTVDTTHFTGNAPGAVEVHGATLPGYPSAAEVAEESVAWVPLVPRTPIVPDAANVLPVADQGRTRITHLRLTIHP 160
162454153  85 GILRGVIVDTAFFRGNYPEHCSIEACAARPDARVEDLLDPRTHWVEILPRSPLAGDSQNAFELTSSSRF--THLRLNIYP 162
158317428 161 DGGVARLRVHGVVVPDPRLLDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGDARAMGEGWETRRRRGPGHDWAVV 238
111220914 174 DGGVARLRVHGTVVPDPRLLDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGDARAMGEGWETRRRRGTGHDWAAV 251
86739553  161 DGGVARLRVHGTVVPDPRMFDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGEARAMGEGWETRRRRGDGHDWAVV 238
162454153 163 DGGVARLRVHGDALPDVRRQGRpgAEIDLAAAENGGRVLSCSDMFFGVRHNLIMPGRAANMGDGWETRRRRGPGYDWALV 242
158317428 239 RLATEGTVVRAEVDTRHFRGNAPRAVALWAANAPttgdDDLATDALSAITDWRPLLPRTRVQPNTRHLFDLEVPVEA--T 316
111220914 252 RLTTQGLIVRAEVDTRHFRGNAPRAVELWAADYP----DLLDPDDIDAITEWVPLLPRTRVQPNTRHLFDLEVPVQA--T 325
86739553  239 RLATQGTIVRAEVDTRHFRGNAPRAVALWAADNP----DLLDPDDVTAITEWYPMLPRTRVQPNTRHLFDLEVPIQA--T 312
162454153 243 ALAAQGEIARIEVDTNHFKGNYPDSCMIEGIDAA-----GRSAAELAGAGGWREIVPRTKLQAHTRHLFEEDLRATGpfT 317
158317428 317 HVRVDAIPDGGLARLRLVGAPTEAGRESLAMRWFDSLTPAAAREELLACCGSEDWADAVTALRPFDTLATLLPAAEQEWW 396
111220914 326 HVRVDAIPDGGLARLRLTGVPTATGREALAMRWFDALSPDAAREELLACCESEDWAEAVVARRPFGTLAALLPAAEQEWW 405
86739553  313 HVRVDAIPDGGLARLRLTGAPTPVGREALAMRWFDALSPDAAREELLACCESEDWAAAVAARRPFGTLAALLPAAEQEWW 392
162454153 318 HVRLNIYPDGGVSRLRIFGEATRSGAAEQRLRWLNALTEPEAEAELRVACGASAWASQVAAARPFRDEEHLSAAAAQAFA 397
158317428 397 NLPETAWLEAFTAHPRIGERPTPAPTPPTSSRATVVSLDAPRREQAALDQASEDVRAAFAEGNAEYEDRFGFIFLVRAAG 476
111220914 406 RLPESAWFEAFTAHPRIGERPTGIPAPPTTSRASVVSLDAPRREQAAMDEAPEAIKAAFVSGNAAYEERFGYIFLVRAAG 485
86739553  393 NLPASAWLEAFTAHPRIGERPAHTPAPPTTARATVVSLDAPRREQAAMDQATAEVRAAFEQGNAAYEERFGYIFLVRAAG 472
162454153 398 RLAPEDWLEAFRAHPRIGETRPQAEAAEASATARRFS----SQEQAGMSAAAVDTREALARLNRAYDEKFGFIYIVCATG 473
158317428 477 RGAQEMLELLRERMANDPRTELRVAAGQQAEITALRLRHLITGA 520
111220914 486 RGAEEMLALLQERMAHEPDEELRIAAGQQAEITALRIRHLITGA 529
86739553  473 RDAEEMLALLRARLDNDPADELRIAAGQQAEITALRIRRLITGA 516
162454153 474 KSADEMLEALRARLEHTQEQELPIAADEQRKITAIRLKKLLWGG 517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap