Conserved Protein Domain Family
PRK13792

?
PRK13792: PRK13792 
lysozyme inhibitor; Provisional
Statistics
?
PSSM-Id: 106733
View PSSM: PRK13792
Aligned: 4 rows
Threshold Bit Score: 271.204
Threshold Setting Gi: 15596064
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15596064    1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80 
152986730   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80 
116048791   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80 
218893164   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80 
15596064   81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
152986730  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
116048791  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
218893164  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap