Conserved Protein Domain Family
PRK13787

?
PRK13787: PRK13787 
adenylosuccinate synthetase; Provisional
Statistics
?
PSSM-Id: 172324
View PSSM: PRK13787
Aligned: 6 rows
Threshold Bit Score: 856.559
Threshold Setting Gi: 24213810
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183221317   1 MPANLVVGAQWGDEGKAKVIDYLSKDTDIIVRYQGGANAGHTVVVGGKKYIFHLVPSGIIYDNTTCVIGNGVVLDPEYFL 80 
116332147   1 MPASLVVGTQWGDEGKAKVIDFLSKDTDIIVRYQGGANAGHTVVVHGKKYVFHLVPSGVIYDQTICVIGNGVVLDPLFFI 80 
24213810    1 MPASLVVGTQWGDEGKAKVIDFLSKDTDIIVRYQGGANAGHTVVVHGKKYVFHLVPSGVIYDQTICVIGNGVVLDPLFFI 80 
116327200   1 MPASLVVGTQWGDEGKAKVIDFLSKDTDIIVRYQGGANAGHTVVVHGKKYVFHLVPSGVIYDQTICVIGNGVVLDPLFFI 80 
45658406    1 MPASLVVGTQWGDEGKAKVIDFLSKDTDIIVRYQGGANAGHTVVVHGKKYVFHLVPSGVIYDQTICVIGNGVVLDPLFFI 80 
189911408   1 MPANLVVGAQWGDEGKAKVIDYLSKDTDIIVRYQGGANAGHTVVVGGKKYIFHLVPSGIIYDNTTCVIGNGVVLDPEYFL 80 
183221317  81 KECADLETHGFRVKDKVLISDSCHILLPYHRLIDEAREAGSSPERKIGTTKKGIGMCYADKMLRNGVRAGDLLDKeNLKR 160
116332147  81 EECDRLQKEGFPVYDKLLLSDACHLLFPYHSQIDSARETTVSQEHKIGTTKKGIGICYADKMMRTGLRVGDLLDN-SYES 159
24213810   81 EECDRLQKEGFPVFDKLLLSDACHLLFPYHSQIDSARETTLSQEHKIGTTKKGIGICYADKMMRTGLRVGDLLDT-SYQT 159
116327200  81 EECDRLQKEGFPVYDKLLLSDACHLLFPYHSQIDSARETTVSQEHKIGTTKKGIGICYADKMMRTGLRVGDLLDN-SYES 159
45658406   81 EECDRLQKEGFPVFDKLLLSDACHLLFPYHSQIDSARETTLSQEHKIGTTKKGIGICYADKMMRTGLRVGDLLDT-SYQT 159
189911408  81 KECADLETHGFRVKDKVLISDSCHILLPYHRLIDEAREAGSSPERKIGTTKKGIGMCYADKMLRNGVRAGDLLDKeNLKR 160
183221317 161 KLNHILEVKNQELVKYYDLEPVNPNEMYDFLLDFADKMGKNIINTVYYLNSELEKGKRVLLEGAQGTGLDIDFGTYPYVT 240
116332147 160 RLKHLVDEKNRELDKLYGMPPVSYKDINDGLKFFLSKVRKSIINTAYYLDTELKKGKRVLLEGAQGTGLDVDFGTYPYVT 239
24213810  160 RLKHLVDEKNRELDKLYGMPPVSYNDINEGLKFFLSKVKKNIINTAYYLDTELKKGKRVLLEGAQGTGLDVDFGTYPYVT 239
116327200 160 RLKHLVDEKNRELDKLYGMPPVSYKDINDGLKFFLSKVRKSIINTAYYLDTELKKGKRVLLEGAQGTGLDVDFGTYPYVT 239
45658406  160 RLKHLVDEKNRELDKLYGMPPVSYNDINEGLKFFLSKVKKNIINTAYYLDTELKKGKRVLLEGAQGTGLDVDFGTYPYVT 239
189911408 161 KLNHILEVKNQELVKYYDLEPVNPNEMYDFLLDFADKMGKNIINTVYYLNSELEKGKRVLLEGAQGTGLDIDFGTYPYVT 240
183221317 241 SSNPTTGGALAGSGVSFRYLKDVIGITKAYATRVGEGPFPSEILGEAGDVLRKLGGEYGSTTGRPRRCGWFDVQMIKHAV 320
116332147 240 SSNPTTGGALIGTGISFQHLKHVIGITKAYTTRVGEGPFPTELLGEEGEALRQKGGEFGATTGRPRRCGWFDAEMLKHSV 319
24213810  240 SSNPTTGGALIGTGIPFQHLKHVIGITKAYTTRVGEGPFPTELLGEAGEKLRQKGGEFGATTGRPRRCGWFDVEMLKHSV 319
116327200 240 SSNPTTGGALIGTGISFQHLKHVIGITKAYTTRVGEGPFPTELLGEEGEALRQKGGEFGATTGRPRRCGWFDAEMLKHSV 319
45658406  240 SSNPTTGGALIGTGIPFQHLKHVIGITKAYTTRVGEGPFPTELLGEAGEKLRQKGGEFGATTGRPRRCGWFDVEMLKHSV 319
189911408 241 SSNPTTGGALAGSGVSFRYLKDVIGITKAYATRVGEGPFPSEILGEAGDVLRKLGGEYGSTTGRPRRCGWFDVQMIKHAV 320
183221317 321 TVNGINSLVLTKIDVLSHYETIPVVVGYEYKGKKLDFFPSQGLEDVKPLFAEYKGWKDDISGINSFAKLPPLCQSYIKSL 400
116332147 320 RINGITSIALTKIDILSDYDRIPVAVGYKLNGKTLDCFPSQGLEKLEIVYEEFPGWKTDISGISEFQKLPEKCKNYISAL 399
24213810  320 RINGITSIALTKIDILSDYDTIPVATGYKLNGKTLDCFPSQGLDKVEVIYEEFPGWKSDISGICEFQKLPEKCKNYISAL 399
116327200 320 RINGITSIALTKIDILSDYDRIPVAVGYKLNGKTLDCFPSQGLEKLEIVYEEFPGWKTDISGISEFQKLPEKCKNYISAL 399
45658406  320 RINGITSIALTKIDILSDYDTIPVATGYKLNGKTLDCFPSQGLDKVEVIYEEFPGWKSDISGICEFQKLPEKCKNYISAL 399
189911408 321 TVNGINSLVLTKIDVLSHYETIPVVVGYEYKGKKLDFFPSQGLEDVKPLFAEYKGWKDDISGINSFAKLPPLCQSYIKSL 400
183221317 401 QELVNTKIGIVSTGPDRDHTIIMD 424
116332147 400 EKWIGVKINLVSTGPDRKDTIQGD 423
24213810  400 EKWIGVKINLVSTGPDRKDTIHGD 423
116327200 400 EKWIGVKINLVSTGPDRKDTIQGD 423
45658406  400 EKWIGVKINLVSTGPDRKDTIHGD 423
189911408 401 QELVNTKIGIVSTGPDRDHTIIMD 424
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap