Conserved Protein Domain Family
PRK13784

?
PRK13784: PRK13784 
adenylosuccinate synthetase; Provisional
Statistics
?
PSSM-Id: 172322
View PSSM: PRK13784
Aligned: 9 rows
Threshold Bit Score: 824.269
Threshold Setting Gi: 187932236
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56707368    1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLRQHTKCVIGHGVVLDPVALD 80 
156503405   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
115315509   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
134302691   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
167626867   1 MSNIVIVGAQWGDEGKGKIADTLAEKSDLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHKHTKCVIGHGVVVDPIALD 80 
110669838   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLRQHTKCVIGHGVVLDPVALD 80 
118496792   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
89257173    1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
187932236   1 MSNIVIVGAQWGDEGKGKIADTLAEKADLVVRYQGGNNAGHTLVVNGKKTFLHLIPSGVLHQHTKCVIGHGVVLDPVALD 80 
56707368   81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
156503405  81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
115315509  81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
134302691  81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
167626867  81 TEITRLQDTGIEISANNLFVSESCTVITSYHKLLDAVRENSTTEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDVLRSR 160
110669838  81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
118496792  81 EEITRLQATGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDVLRSR 160
89257173   81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
187932236  81 EEITRLQAKGIAISAENLFVSESCTIITSYHKLLDAVRESNTSEKIGTTGKGIGPAYEDKVSRKGIKFKHLFDKDLLRSR 160
56707368  161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
156503405 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
115315509 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
134302691 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
167626867 161 LALSLAEKETLFKDLYKVEYPSLEEEFERLYTLGQKLKQYSADTFSIIDQAVSTGKNVVYEGAQGVLLDIDYGTYPFVTS 240
110669838 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
118496792 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
89257173  161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDQAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
187932236 161 LAISLAEKETLFRDLYKVEYPTLEQEFDKLFALGQKLKQYAADTFSIIDKAIAAGKNVVYEGAQGVLLDVDYGTYPFVTS 240
56707368  241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
156503405 241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
115315509 241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
134302691 241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
167626867 241 SNTSVAGVYSGATTAGHNLDHVIGITKAYTTRVGEGPFPTELFDDTGLFIQKKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
110669838 241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
118496792 241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
89257173  241 SNTSVAGVYSGATTAGHGLDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
187932236 241 SNTSVAGVYSGATTAGHGFDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVTTGRIRRCGWLDLPLLKYSAK 320
56707368  321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
156503405 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
115315509 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
134302691 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
167626867 321 CSNLTSIALTKVDVLSDLDTLKICIGYKYEGKEIFCAYPGIDLYKVEPILVDMEPFSLDEVVTKENMPSALKTYLRTIEN 400
110669838 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
118496792 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGREIYCAYPGIDLYKVEPILVEMEPFSINETVTKDNIPAALKTYLKTIEN 400
89257173  321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLKTIEN 400
187932236 321 CSNLTSIALTKVDVLSDMDTLKVCIGYKYEGKEIYCAYPGIDLYKVEPILVEMEPFSIDETVTKDNMPAALKTYLETIEN 400
56707368  401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
156503405 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
115315509 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
134302691 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
167626867 401 HIGIPISSLAYGPSREQILFFEDYFKKG 428
110669838 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
118496792 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
89257173  401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
187932236 401 HVGIPISSLAYGPSREQILFFEDYFKKG 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap