Conserved Protein Domain Family
PRK13782

?
PRK13782: PRK13782 
HPr family phosphocarrier protein
Statistics
?
PSSM-Id: 172320
View PSSM: PRK13782
Aligned: 34 rows
Threshold Bit Score: 139.532
Threshold Setting Gi: 30023186
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30023186   1 MVQKRVQVSLKNGLQARPAALFVQEANRFHADIFIEKDGKTVNAKSIMGIMSLAIGTGSMITITTEGSDAEEALEALAAY 80 
52082018   1 MVQQKVEVLLKTGLQARPAALFVQEANRFQSDIFLEKGDKKVNAKSIMGLMSLAVSSGSEVTLIADGSDEQDALDALTAY 80 
52787405   1 MVQQKVEVLLKTGLQARPAALFVQEANRFQSDIFLEKGDKKVNAKSIMGLMSLAVSSGSEVTLIADGSDEQDALDALTAY 80 
23099920   1 MVEKLVTVELDTGLQARPAAQFVQEANRFSSHVFLEKDDKKINAKSIMGLMSLAITKGEQIKLIAEGPDEDTAIEHLEKY 80 
157693864  1 MVEKTVTIQLKTGLQARPAALFVQEANRFGADIFLEKDGKKVNAKSIMGLMSLAISSGVTITLIADGADEQEAIEALTDF 80 
138896649  1 MVEKQVEVKLKTGLQARPAALFVQEANRFSADVFLEKDGKRVNAKSIMGLMSLAIGHGAVITLIADGPDAQEAVEKLAAY 80 
154687596  1 MVQEKVEVRLKTGLQARPAALFVQEANRFASDVFLEKNGKKVNAKSIMGLMSLAVSTGTEVTLIAEGDDEKEALEKLSAY 80 
239828282  1 MVEKQVEVRLKTGLQARPAALFVQEANRFSSDIYLEKDGKKVNAKSIMGLMSLAISTGSVIKLIADGPDENEAIEKLANY 80 
261420501  1 MVEKQVEVRLKTGLQARPAALFVQEANRFSADVFLEKDGKRVNAKSIMGLMSLAIGHGAVITLIADGPDEQEAIEKLAAY 80 
297531316  1 MVEKQVEVKLKTGLQARPAALFVQEANRFSADVFLEKDGKRVNAKSIMGLMSLAIGHGAVITLIADGPDEQEAIEKLAAY 80 
30023186  81 VQ 82 
52082018  81 VQ 82 
52787405  81 VQ 82 
23099920  81 VY 82 
157693864 81 VN 82 
138896649 81 VQ 82 
154687596 81 VQ 82 
239828282 81 VQ 82 
261420501 81 VQ 82 
297531316 81 VQ 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap