Conserved Protein Domain Family
PRK13775

?
PRK13775: PRK13775 
formimidoylglutamase; Provisional
Statistics
?
PSSM-Id: 172313
View PSSM: PRK13775
Aligned: 16 rows
Threshold Bit Score: 695.954
Threshold Setting Gi: 21911316
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157151630   1 MLEDYYQLDNSYYQRGVEDNLYAAKWGMVIEFLNLNDPNLKPVEGVNFALIGFKSDKGVYINHGRVGAVEGPQSIRTQLA 80 
139474536   1 MLEDYYPSTTSYYHGGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 80 
71904424    4 MLEDYYPSTTSYYHGGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 83 
94995266    4 MLEDYYPSTTSYYHSGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 83 
94989419    4 MLEDYYPSTTSYYHGGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 83 
94991353    4 MLEDYYPSTTSYYHSGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 83 
21911316    1 MLEDYYPSTTSYYHSGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 80 
50915122    4 MLEDYYPSTTSYYHGGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 83 
19746962    1 MLEDYYPSTTSYYHGGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 80 
28896689    1 MLEDYYPSTTSYYHSGIDDDLYTAKWGMVMTFLDLNDSSLTPFEGTHFALIGFKSDKGVYINNGRVGAVESPAAIRTQLA 80 
157151630  81 KLPWHLGRNVHVFDVGDIDGPNRSLEQLQSSLAKAVKRLRELNLRPIVLGGGHETAYGNYLGLKSSLKPEQELAVINMDA 160
139474536  81 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDFNLKPIVLGGGHETAYGHYLGLRQSLSPSDDLAVINMDA 160
71904424   84 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSPSDDLAVINMDA 163
94995266   84 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSSSDDLAVINMDA 163
94989419   84 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSPSDDLAVINMDA 163
94991353   84 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSSSDDLAVINMDA 163
21911316   81 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSSSDDLAVINMDA 160
50915122   84 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSPSDDLAVINMDA 163
19746962   81 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSPSDDLAVINMDA 160
28896689   81 KFPWHLGNQVMVYDVGNIDGPNRSLEQLQNSLSKAIKRMCDLNLKPIVLGGGHETAYGHYLGLRQSLSSSDDLAVINMDA 160
157151630 161 HFDLRPYDQTGPNSGTGFRQMFDETLAQKQVFNYLILGIQEHNNNLFLFDFVAKSKAIQFLTGLDIYQMGHKEVCKVVDA 240
139474536 161 HFDLRPYGQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 240
71904424  164 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 243
94995266  164 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 243
94989419  164 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 243
94991353  164 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 243
21911316  161 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 240
50915122  164 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKICRAIDR 243
19746962  161 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 240
28896689  161 HFDLRPYDQTGPNSGTGFRQMFDDAVADKRLFKYFVLGIQEHNNNLFLFDFVAKSKGIQFLTGQDIYQMGHQKVCRAIDR 240
157151630 241 FLADKEQVYLTIDIDCFAAGAAPGVSAIQSLGVDPNLAVLVFQHIAASGKLIGFDVVEVSPPHDIDNHTANLAASFIFYL 320
139474536 241 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 320
71904424  244 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 323
94995266  244 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 323
94989419  244 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASRKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 323
94991353  244 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 323
21911316  241 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 320
50915122  244 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 323
19746962  241 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASRKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 320
28896689  241 FLEGQERVYLTIDMDCFSVGAAPGVSAIQSLGVDPNLAVLVLQHIAASGKLVGFDVVEVSPPHDIDNHTANLAATFIFYL 320
157151630 321 TQVWAQiHD 329
139474536 321 VQIMAQ-HR 328
71904424  324 VQIMAQ-HN 331
94995266  324 VQIMAQ-HN 331
94989419  324 VQIMAQ-HS 331
94991353  324 VQIMAQ-HN 331
21911316  321 VQIMAQ-HN 328
50915122  324 VQIMAQ-HS 331
19746962  321 VQIMAQ-HS 328
28896689  321 VQIMAQ-HN 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap