Conserved Protein Domain Family
PRK13772

?
PRK13772: PRK13772 
formimidoylglutamase; Provisional
Statistics
?
PSSM-Id: 172310
View PSSM: PRK13772
Aligned: 11 rows
Threshold Bit Score: 481.17
Threshold Setting Gi: 33601622
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91778081    1 MRVPFNDKV-WAGRSDDGEAGDTRRVFNQVTPF-GSAVRVQHDAPVIVGFSSDEGVRRNQGRIGAAHAPMELRRVLAGLP 78 
73541281    1 MRMAVTQNP-WQGRVDSGEVGDTTRLFRIVNTLeSSEAKTLGGSPVLLGFGCDAGVLRNQGRAGAAHGPDAIRQALANVP 79 
113866075   1 MTMALTQNL-WQGRVDDGERGDTTRLFRIVHVLeAADVTPLDGAPVLLGFNCDAGVLRNQGRPGAAHGPDAIRQALANVP 79 
94313967   14 TQAEALDAV-WQGRADTGERGDTRRLFNIVQPLaVAASDDLAGATVLIGFACDAGVRRNQGRVGAADGPRGIRRALASLP 92 
163856806   1 MIARLDPAL-WRARDDSAERGDTRRLAHVAS---AAGQGIGAGDPVLIGFACDAGVARNQGRLGAAAAPAAIRRMLAGLP 76 
33601622    1 MSVANDSASiWTARDDSGERGDTRRLAHIV----ALGQDAGAGDAAVLGFACDAGVARNQGRRGAALAPRAIRRMMAGLP 76 
187929864   1 MRTMFDASV-WQGRDDTGERGDVTRLFQVVL---SHDATTLSGVPALLGFACDAGVVRNHGRAGAALGPREIRRALANVP 76 
188590805   1 MRMAVTQNP-WQGRVDHGEQGDTTRLFRIVQALdTADTAPLDHAPVLLGFRCDAGVLRNQGRPGAAHGPDAIRQALANVP 79 
194288794  14 TAATGPDTV-WRGRRDTGEAGDTRRLFDIVA---GPDTPRTPGVPVLLGFCCDAGVVRNQGRPGAAGGPREIRRALAGVP 89 
187919128   1 MRVPFDDKM-WAGRSDDGEPGDTRRVFNQIVPF-DGSLRAHGDTTVVVGFGSDEGVRRNQGRTGAAHAPKELRRALAGLP 78 
241663973   1 MRTMFDASV-WQGRDDTGERGDVTRLFQIVQ---SADATTLSGVPALLGFACDAGVVRNHGRAGAAQGPREIRRALANVP 76 
91778081   79 AkTAMVALADAGDVVCDDGDLEAAQAELADVVSEVLAGGGRPLVLGGGHEVAWGTYSGLRLHQQREAeneatllISRKLL 158
73541281   80 A-HGLPALYDAGNIACEHGDLESAQLALAGSVHNILSRGGFPLVLGGGHEVAWGTWQGLRAHLDARN-------DDGRLL 151
113866075  80 A-HGLPALYDAGNVSCDDGDLESAQLALAGTVRDVLARGGLPLVLGGGHEVAWGTWQGLRAHLDAQD-------DGGRVL 151
94313967   93 V-HDVAALYDAGDVRCEGDALEVTQRALSEVVRAQLDRGALPIVLGGGHEVAWGTWQGLRAHLDTAG-------DAGRVL 164
163856806  77 A-HGFPRLVDAGDIVCDDGHLEDAQDRLAACVANTLAAGARPLVLGGGHEVAWGSFQGLRRWLDGQG-------DRGPVL 148
33601622   77 A-HNLRRLVDAGDVVCEDDQLEAAQDALAGRVAALLQAGAHPVVLGGGHEIAWGSFQGLRRWLDARG-------DREPVL 148
187929864  77 A-HGLSVLADAGDVTCDDGDLEGAQATLGETVCELLDAGARPVVLGGGHEVAFGTYQGLRQHWQKQG-------WCGRLA 148
188590805  80 A-HGLQALYDAGNVSCDDGDLESAQQALADAVHAVLARGGFPLVLGGGHEVAWGTWQGLRAHLDAQH-------DDGRVL 151
194288794  90 A-HGIGRLIDGGDVHCEGDALEHAQQRLGQAVAAELAVGAWPLVLGGGHEVAWGTWQGLRMHLDARG-------DRGRVL 161
187919128  79 AkNSMAMLADAGDVACDDGDLEGAQAELANVISEVLASGGRPLVFGGGHEVAWATYCGLVLHQHRREade--saTPRKLL 156
241663973  77 A-HGLSALADAGDVTCDDGDLERAQTALAECVCELLDAGARPVLLGGGHEVAFGTHQGLRQHWQKQG-------WGGRLA 148
91778081  159 IINFDAHFDLRQKRPANSGTPFDQIALDCAERGVPFNYACFGISDLSNTASLFAHAERLGVHYVFDVDMQETQLPQRLNE 238
73541281  152 IINIDAHFDLRTSRPASSGTPFDQIANACAERGQPFDYVCLGVSRLSNTPALFSRAHALGVSYVEDVDMQERHLASRLAE 231
113866075 152 IINIDAHFDLRTSRPASSGTPFDQIANACAERGQPFDYVCLGVSRLSNTPALFSRADALGVCYVEDVDMQERHLESRLAE 231
94313967  165 ILNLDAHFDLRTARPGSSGTPFDQIAEACRAAGQPFDYACLGVSRLGNTASLFAHAQALGVRYVEDTEMQERHLDHRLAE 244
163856806 149 VLNLDAHFDLRTGRPASSGTPFDQIAEHCAAAGHAWQYACYGVSRLGNTAALYARAAEIGAVWVEDRDLQERHLDARLAE 228
33601622  149 VLNLDAHFDLRTGRPGSSGTPFDQIAEYCAARGHALQYACLGVSPLGNTPALYARAAEVGAVWVEDRHMQEAHLGERLAQ 228
187929864 149 VVNFDAHFDLRTSRPGNSGTPFDQIAEDCAAHGIDLTYCCLGVSRLSNTPALFDRADALHAHYVEDTVMQERHLDARTAD 228
188590805 152 IVNIDAHFDLRTSRPASSGTPFDQIAHACAERGQPFDYVCLGVSRLANTPALFGRAEALGVCYVEDVDMQERHLAARLAE 231
194288794 162 IVNLDAHFDLRASRPGSSGTPFDQIAADCRQRGLPFDYACLGVSRLANTAALFARAHALGVRHVEDTELQERHLDARLAE 241
187919128 157 IINFDAHFDLRQKRPANSGTPFDQIANDCAERRVPFNYVCFGISDLGNTASLFVHAQRLGVRYALDVDMQETQLPLRLQE 236
241663973 149 VVNFDAHFDLRTSRPGNSGTPFDQIAEDCAAHGIDLTYCCLGVSRLSNTPALFDRADALHAHYVEDTDMQERHLDARMAD 228
91778081  239 LQKLLDAADDVYLTIDLDVLPAATAPGVSAPAALGVPLSVIEAMVLRVRASGKLRVADIAEYNPTLDQDRRTARVAARLA 318
73541281  232 LAARIDATDHVYLTIDLDALPATVMPGVSAPAAYGVPLPVVEEIALLARRSGKLRAADLAEYNPQYDRDNLGARVAARLA 311
113866075 232 LAARIDATDHLYLTIDLDALPAAVMPAVSAPAACGVPLTVVEEIAMLARHSGKLRVADLAEYNPQYDRDHQGARVAARLA 311
94313967  245 IDAMLAQAAHVYLTIDLDVLPAAVMPGVSAPAAYGVPISVIEAIVTHVRGSGKLRAADLAEFNPQFDRDGQSARVAARLV 324
163856806 229 IDGLLDAAAHVYLTIDIDVLPAAVAPGVSAPAAYGVPLSVVEEIALRVRRSGKLRVADLAECNPAFDLDNRTARVAARLA 308
33601622  229 LDALLAAAGHVYLTIDLDVLPAATAPGVSAPAPYGVPLAVVEEVAMHVRASGKLRLADLAECNPAYDIDHRTARVAARLA 308
187929864 229 LDTWLADADHVYLTIDMDVLAAAVAPGVSAPAAYGITLPMLEALVQHVCATGKVRVADIAETNPEYDQDRRTVRVAARLA 308
188590805 232 LSARIDAADHVYLTIDLDALPGAVMPGVSAPAAYGVPLPVVEEVVGLVRRSGKLRVADLAEYNPQYDRDHLGARVAARLA 311
194288794 242 LERWVADADHVYLSIDLDVLPAAVMPGVSAPAAYGVPLAVVEAIATLLRDSGKLRVADIAEFNPLYDRDGCGARVAARLG 321
187919128 237 LDLMLDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMVRRVRGSGKLRAADIAEYNPSLDQDRRTARAAARLA 316
241663973 229 LDAWLADADHVYLTIDMDVLAAAVAPGVSAPAAYGITLPVLEALVQHVCATGKVRVADIAETNPEYDQDRRTVRVAARLA 308
91778081  319 YRLL 322
73541281  312 WRLL 315
113866075 312 WRLF 315
94313967  325 YRLI 328
163856806 309 WQLL 312
33601622  309 WRLL 312
187929864 309 YHLL 312
188590805 312 WRLL 315
194288794 322 YRLV 325
187919128 317 YRLL 320
241663973 309 YHLL 312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap