Conserved Protein Domain Family
PRK13770

?
PRK13770: PRK13770 
histidinol dehydrogenase; Provisional
Statistics
?
PSSM-Id: 172308
View PSSM: PRK13770
Aligned: 19 rows
Threshold Bit Score: 730.892
Threshold Setting Gi: 224476126
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57651070    3 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 82 
73661738    2 IIDKTLFLKKYLNQSSLNEDLYPIVKDICENVRLHGDDALRNYNQQFDQVETCNLEVAYQTLENAYNRLDSDLREALQQS 81 
88196631    1 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 80 
57865756    1 MLSAQQFLKEFNNVESLDESLYEIVSQICEEVKLQGDKALKNYNLQFDQVETEKLELEQSQLKNAYDMLDNETRDALEQS 80 
27467190    1 MLSAQQFLKEFNNVESLNESLYEIVSHICEEVKLQGDKALKNYNLQFDQVETEKLELEQSQLKNAYDMLDNETRDALEQS 80 
151222788   1 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 80 
87161366    1 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 80 
161510885   3 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 82 
150395193   1 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 80 
15925668    1 MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHEQIKAAFDTLDEKTKQALQQS 80 
57651070   83 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 162
73661738   82 HARIQSYQESIKWTKQQ--GTSDCYELYHPLERVGVYVPGGKASYPSTVLMTVTLAKVAGVKNISVVTPPQLNGIPDIVL 159
88196631   81 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 160
57865756   81 YQRIKVYQENIK-VKQESSQQTECYERYHPIERVGIYVPGGKASYPSTVLMTATLAQVAGVNEITVVTPPQNSGICQEVL 159
27467190   81 YQRIKVYQENIK-VKQESSQQTECYERYHPIERVGIYVPGGKASYPSTVLMTATLAQVAGVNEITVVTPPQNNGICQEVL 159
151222788  81 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 160
87161366   81 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 160
161510885  83 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 162
150395193  81 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 160
15925668   81 YERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVL 160
57651070  163 AACYITQVDQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV 242
73661738  160 AACYIAGVDNVYQVGGAQSIAALAYGTETLPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPSEIALIIDDSADLDAIA 239
88196631  161 AACYITQVDQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV 240
57865756  160 AACYITGVHHVYQVGGAQSIAALTYGTETIKKVDKIVGPGNQYVAYAKKFVFGQVGIDQIAGPTEIALIIDESADLDAIA 239
27467190  160 AACYITGVHHVYQVGGAQSIAALTYGTETIKKVDKIVGPGNQYVAYAKKFVFGQVGIDQIAGPTEIALIIDESADLDAIA 239
151222788 161 AACYITQVDQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV 240
87161366  161 AACYITQVDQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV 240
161510885 163 AACYITQVDQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDETADLDAIV 242
150395193 161 AACYITQVNQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDAIV 240
15925668  161 AACYITQVNQVFQVGGAQSIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDAIV 240
57651070  243 YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 322
73661738  240 YDVFAQAEHDELARTFVISEDEALLKQLEQKIQHILPQIERQSIVQASLNDNHFLIHVNNFSEACDLMNQIAPEHASIQT 319
88196631  241 YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 320
57865756  240 YDVFAQAEHDEMACTYVISENEKVLNQLNTIIQEKLQYVERQDIISQSIANHHYLILAQDTEEACLIMNTIAPEHASIQT 319
27467190  240 YDVFAQAEHDEMACTYVISENEKVLNQLNTIIQEKLQYVERQDIISQSIANHHYLILAQDTEEACLIMNTIAPEHASIQT 319
151222788 241 YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 320
87161366  241 YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 320
161510885 243 YDVFAQAEHDELARTYAISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 322
150395193 241 YDVFAQAEHDELARTYVIGEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 320
15925668  241 YDVFAQAEHDELARTYVIGEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASNFDEACHVMNTIAPEHASIQT 320
57651070  323 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 402
73661738  320 VSPHDYLNHVRYVGALFLGYYSPEVIGDYVAGPSHVLPTNQTARFTNGLSVNDFLTRHSVIDLSKDTFDTVELTARKLAH 399
88196631  321 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 400
57865756  320 RAPEMYIDKVKYVGALFLGHFSPEVIGDYVAGPSHVLPTNQTARFTNGLSVNDFMTRHSVIHLSQKTFNEVAESAEHIAH 399
27467190  320 RAPEMYIDKVKYVGALFLGHFSPEVIGDYMAGPSHVLPTNQTARFTNGLSVNDFMTRHSVIHLSQKTFNEVAESAEHIAH 399
151222788 321 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 400
87161366  321 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 400
161510885 323 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 402
150395193 321 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 400
15925668  321 VNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAH 400
57651070  403 VEALYNHQQSILIRQS 418
73661738  400 VEQLYNHEQSIEIRTS 415
88196631  401 VEALYNHQQSILIRQS 416
57865756  400 IESLFNHEKSIHVRR- 414
27467190  400 IESLFNHEKSIHVRR- 414
151222788 401 VEALYNHQQSILIRQS 416
87161366  401 VEALYNHQQSILIRQS 416
161510885 403 VEALYNHQQSILIRQS 418
150395193 401 VEALYNHQQSILIRQS 416
15925668  401 VEALYNHQQSILIRQS 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap