Conserved Protein Domain Family
PRK13769

?
PRK13769: PRK13769 
histidinol dehydrogenase; Provisional
Statistics
?
PSSM-Id: 172307
View PSSM: PRK13769
Aligned: 5 rows
Threshold Bit Score: 616.514
Threshold Setting Gi: 171184637
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126458762   2 RRGGLPRDVVKGVEAVVDDVAERGLEAALRYSEQFDGVKPSAPIVEPRAGGDPAVVKAALEAAESLRRVYKRLVPPDAVD 81 
145590432   1 MRRGFPRDVLETAGKIIDDVRDGGLDAALKYSERLDGEAPREVLIAPRPGGDPSVVGAALEAARSLEALYRKLAPPSAVD 80 
18312330    1 -MRGFPREVLESVWKIVDDVQSGGLKAALEYSKRLDGVAPEPHLVTPRQGGDPEVVSAALAAAKSLEALYSRISPPAAVD 79 
119872718   1 MRRILPRDVVKSVEEIVDDVTERGLQAALEYSRRFDGVVPERALLEPRPGGDPDVVAAALEVAKSLEMLYSKLKPPEAVD 80 
171184637   1 MRRVLPRDVVKSVEEIVDDVAERGLQAALEYSRRLDGVAPESALLEPRPGGDPGVVAAALEVAKSLETLYSRLKPLEAVD 80 
126458762  82 YYGGFMRLVSWRPVDKAALYVPARYISTLVMLAVPASLAGVREIYVVTPPRGVTEELLAVAKELGVKGVLQIGGPHGLAY 161
145590432  81 YYGGVLRTVVWKPVRRAALYVPARYVSTLVMLAMPAKAAGVEELYVVTPPRGVTGEVLGVAKELGIKAVLALGGAHGLAY 160
18312330   80 FYGGILRQILWKPVRRAALYVPARYISTLVMLAVPARLAGVEEVYVVTPPRGVSEELLAVAKELGVKAVLALGGPHGLAY 159
119872718  81 FYGGVLRSVFWRPVRSVALYVPARYVSTLVMLAVPARAAGVEKIYVVTPPKGATGELLAVAKELDVAGVIPIGGPHGLAY 160
171184637  81 FYGGVLRSVFWKPVRSVALYVPARYVSTLVMLAVPARAAGVEKIYVVTPPKGATGELLAVAKELGVAGVVPIGGPHGLAY 160
126458762 162 AVFHIGVDVVAGPGGLYVQAGKYVLSQYVGVDGIEGPTELVVYAEGVAPEVAAKGAMAQLEHGPTSFAHVLSPDEELLRA 241
145590432 161 AAFHLGVDMLAGPGGLYVQAAKFLLSQYVGIDGIEGPTELVVYAEGVPPETAARGALAQLEHGPTSFAYVLSTDASLLKG 240
18312330  160 AVFHMGVDVVAGPGGLYVQAAKYILSQYVGIDGIEGPTELVIYAEGVPPEVAVRGALAQLEHGPTSFAYLLSPDGELLKK 239
119872718 161 AVFHMGVDMVAGPGGLYVQAAKYVLSLHVGIDGIEGPTELVVYAEGVPPEKAVAGALAQLEHGPTSFAYLVSTDSGLLEA 240
171184637 161 SVFHMGVDMVAGPGGLYVQAAKYVLSLHAGIDGIEGPTELVVYAEGVPPEKAVAGALAQLEHGPTSFAYLVSTDAGLLEA 240
126458762 242 VEEIYRREKTSSMGPLHVKKVAGVEEAARVVDEIAPEHLEVWGRRELAFMVKNVGAVSINAPSPYLDYVAGICHVLPTGG 321
145590432 241 VEEVYKREKTSSMGPLETRQVSSVEEAVEFIDTVAPEHLEVWGRRDVAYRVRNVGAVSVNMPSPYLDYVAGISHVLPTGG 320
18312330  240 AEELYVRERTSSMGPLKVKKVGGIDEAVSFIDEIAPEHLEVWGRREVAYRVRNVGAVSVNMPSPYLDYVAGISHVLPTGG 319
119872718 241 AAEIYRRERTSSMGPLEVRKVHDVEEAVRLIDSIAPEHLEVWGAREVAYRVRNVGAVSVNMPSPYLDYAAGISHVLPTGG 320
171184637 241 AAEIYRRERTSSMGPLEVRKVNDVGEAVKLIDSIAPEHLEVWGAREVAYRVRNVGAVSVNMPSPYLDYAAGISHVLPTGG 320
126458762 322 TARWRGPVTPLNFLKPIGVAEAVGSVDpaLAEAARVLAKYEGFQRHFEAI 371
145590432 321 TARWRGIITPLTFMKAVGIAEAVGEIK--LAEAARRLAQYEGFQLHYRAL 368
18312330  320 TARWRGVITPLAFMKPIGIAEAVGELT--LREAARKLAEYEGFKYHGEAL 367
119872718 321 SARWRGIITPATFMKPIGVAEAVGRLE--LLEAARRLAEYEGFRYHRQAL 368
171184637 321 SAKWRGIITPATFMKPIGVAEAVGRLE--LLEAARRLAEYEGFRYHRQAL 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap